diff --git a/go.mod b/go.mod index 6cc4dd2..9f55a7e 100644 --- a/go.mod +++ b/go.mod @@ -3,7 +3,7 @@ module github.com/DistroByte/molecule go 1.26.0 require ( - github.com/getkin/kin-openapi v0.133.0 + github.com/getkin/kin-openapi v0.136.0 github.com/go-chi/chi/v5 v5.2.5 github.com/google/uuid v1.6.0 github.com/hashicorp/nomad/api v0.0.0-20260220212019-daca79db0bd6 @@ -15,6 +15,7 @@ require ( require ( github.com/clipperhouse/uax29/v2 v2.7.0 // indirect github.com/go-viper/mapstructure/v2 v2.5.0 // indirect + github.com/santhosh-tekuri/jsonschema/v6 v6.0.2 // indirect github.com/woodsbury/decimal128 v1.3.0 // indirect gopkg.in/yaml.v3 v3.0.1 // indirect ) @@ -36,13 +37,11 @@ require ( github.com/mattn/go-isatty v0.0.20 // indirect github.com/mattn/go-runewidth v0.0.20 // indirect github.com/mitchellh/go-homedir v1.1.0 // indirect - github.com/mitchellh/mapstructure v1.5.0 // indirect github.com/mohae/deepcopy v0.0.0-20170929034955-c48cc78d4826 // indirect - github.com/oasdiff/yaml v0.0.0-20250309154309-f31be36b4037 // indirect - github.com/oasdiff/yaml3 v0.0.0-20250309153720-d2182401db90 // indirect + github.com/oasdiff/yaml v0.0.9 // indirect + github.com/oasdiff/yaml3 v0.0.12 // indirect github.com/perimeterx/marshmallow v1.1.5 // indirect github.com/pmezard/go-difflib v1.0.0 // indirect - github.com/rivo/uniseg v0.4.7 // indirect golang.org/x/sys v0.41.0 // indirect golang.org/x/text v0.34.0 // indirect ) diff --git a/go.sum b/go.sum index 9c4850f..06a8c59 100644 --- a/go.sum +++ b/go.sum @@ -3,13 +3,14 @@ github.com/clipperhouse/uax29/v2 v2.7.0/go.mod h1:EFJ2TJMRUaplDxHKj1qAEhCtQPW2tJ github.com/coreos/go-systemd/v22 v22.5.0/go.mod h1:Y58oyj3AT4RCenI/lSvhwexgC+NSVTIJ3seZv2GcEnc= github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c= github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= +github.com/dlclark/regexp2 v1.11.0 h1:G/nrcoOa7ZXlpoa/91N3X7mM3r8eIlMBBJZvsz/mxKI= +github.com/dlclark/regexp2 v1.11.0/go.mod h1:DHkYz0B9wPfa6wondMfaivmHpzrQ3v9q8cnmRbL6yW8= github.com/docker/go-units v0.5.0 h1:69rxXcBk27SvSaaxTtLh/8llcHD8vYHT7WSdRZ/jvr4= github.com/docker/go-units v0.5.0/go.mod h1:fgPhTUdO+D/Jk86RDLlptpiXQzgHJF7gydDDbaIK4Dk= -github.com/felixge/httpsnoop v1.0.3 h1:s/nj+GCswXYzN5v2DpNMuMQYe+0DDwt5WVCU6CWBdXk= -github.com/felixge/httpsnoop v1.0.3/go.mod h1:m8KPJKqk1gH5J9DgRY2ASl2lWCfGKXixSwevea8zH2U= github.com/felixge/httpsnoop v1.0.4 h1:NFTV2Zj1bL4mc9sqWACXbQFVBBg2W3GPvqp8/ESS2Wg= -github.com/getkin/kin-openapi v0.133.0 h1:pJdmNohVIJ97r4AUFtEXRXwESr8b0bD721u/Tz6k8PQ= -github.com/getkin/kin-openapi v0.133.0/go.mod h1:boAciF6cXk5FhPqe/NQeBTeenbjqU4LhWBf09ILVvWE= +github.com/felixge/httpsnoop v1.0.4/go.mod h1:m8KPJKqk1gH5J9DgRY2ASl2lWCfGKXixSwevea8zH2U= +github.com/getkin/kin-openapi v0.136.0 h1:mJC/W0ZFnwGYkUUwujw+LmWGFuKcqHklJjpl8JAH5eE= +github.com/getkin/kin-openapi v0.136.0/go.mod h1:f97ss9nLJZRi9fm0vSwKZa4KrPMltWnZf9peal6MBrs= github.com/go-chi/chi/v5 v5.2.5 h1:Eg4myHZBjyvJmAFjFvWgrqDTXFyOzjj7YIm3L3mu6Ug= github.com/go-chi/chi/v5 v5.2.5/go.mod h1:X7Gx4mteadT3eDOMTsXzmI4/rwUpOwBHLpAfupzFJP0= github.com/go-openapi/jsonpointer v0.21.0 h1:YgdVicSA9vH5RiHs9TZW5oyafXZFc6+2Vc1rr/O9oNQ= @@ -27,15 +28,10 @@ github.com/google/go-cmp v0.6.0 h1:ofyhxvXcZhMsU5ulbFiLKl/XBFqE1GSq7atu8tAmTRI= github.com/google/go-cmp v0.6.0/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY= github.com/google/uuid v1.6.0 h1:NIvaJDMOsjHA8n1jAhLSgzrAzy1Hgr+hNrb57e+94F0= github.com/google/uuid v1.6.0/go.mod h1:TIyPZe4MgqvfeYDBFedMoGGpEw/LqOeaOT+nhxU+yHo= -github.com/gorilla/websocket v1.5.0 h1:PPwGk2jz7EePpoHN/+ClbZu8SPxiqlu12wZP/3sWmnc= -github.com/gorilla/websocket v1.5.0/go.mod h1:YR8l580nyteQvAITg2hZ9XVh4b55+EU/adAjf1fMHhE= github.com/gorilla/websocket v1.5.3 h1:saDtZ6Pbx/0u+bgYQ3q96pZgCzfhKXGPqt7kZ72aNNg= github.com/gorilla/websocket v1.5.3/go.mod h1:YR8l580nyteQvAITg2hZ9XVh4b55+EU/adAjf1fMHhE= -github.com/hashicorp/cronexpr v1.1.2 h1:wG/ZYIKT+RT3QkOdgYc+xsKWVRgnxJ1OJtjjy84fJ9A= -github.com/hashicorp/cronexpr v1.1.2/go.mod h1:P4wA0KBl9C5q2hABiMO7cp6jcIg96CDh1Efb3g1PWA4= github.com/hashicorp/cronexpr v1.1.3 h1:rl5IkxXN2m681EfivTlccqIryzYJSXRGRNa0xeG7NA4= github.com/hashicorp/cronexpr v1.1.3/go.mod h1:P4wA0KBl9C5q2hABiMO7cp6jcIg96CDh1Efb3g1PWA4= -github.com/hashicorp/errwrap v1.0.0 h1:hLrqtEDnRye3+sgx6z4qVLNuviH3MR5aQ0ykNJa/UYA= github.com/hashicorp/errwrap v1.0.0/go.mod h1:YH+1FKiLXxHSkmPseP+kNlulaMuP3n2brvKWEqk/Jc4= github.com/hashicorp/errwrap v1.1.0 h1:OxrOeh75EUXMY8TBjag2fzXGZ40LB6IKw45YeGUDY2I= github.com/hashicorp/errwrap v1.1.0/go.mod h1:YH+1FKiLXxHSkmPseP+kNlulaMuP3n2brvKWEqk/Jc4= @@ -45,8 +41,6 @@ github.com/hashicorp/go-multierror v1.1.1 h1:H5DkEtf6CXdFp0N0Em5UCwQpXMWke8IA0+l github.com/hashicorp/go-multierror v1.1.1/go.mod h1:iw975J/qwKPdAO1clOe2L8331t/9/fmwbPZ6JB6eMoM= github.com/hashicorp/go-rootcerts v1.0.2 h1:jzhAVGtqPKbwpyCPELlgNWhE1znq+qwJtW5Oi2viEzc= github.com/hashicorp/go-rootcerts v1.0.2/go.mod h1:pqUvnprVnM5bf7AOirdbb01K4ccR319Vf4pU3K5EGc8= -github.com/hashicorp/nomad/api v0.0.0-20250317133216-16bbdd983307 h1:dJVFZM5wiEc8XGGduWPyxa2i0NwbeeqTCoffSKXrBS0= -github.com/hashicorp/nomad/api v0.0.0-20250317133216-16bbdd983307/go.mod h1:svtxn6QnrQ69P23VvIWMR34tg3vmwLz4UdUzm1dSCgE= github.com/hashicorp/nomad/api v0.0.0-20260220212019-daca79db0bd6 h1:QN/GwpGyiW8RdNcHGMA1xVnM8tJkAGNDR/BZ47XR+OU= github.com/hashicorp/nomad/api v0.0.0-20260220212019-daca79db0bd6/go.mod h1:KkLNLU0Nyfh5jWsFoF/PsmMbKpRIAoIV4lmQoJWgKCk= github.com/jedib0t/go-pretty/v6 v6.7.8 h1:BVYrDy5DPBA3Qn9ICT+PokP9cvCv1KaHv2i+Hc8sr5o= @@ -59,47 +53,37 @@ github.com/kr/text v0.2.0 h1:5Nx0Ya0ZqY2ygV366QzturHI13Jq95ApcVaJBhpS+AY= github.com/kr/text v0.2.0/go.mod h1:eLer722TekiGuMkidMxC/pM04lWEeraHUUmBw8l2grE= github.com/mailru/easyjson v0.7.7 h1:UGYAvKxe3sBsEDzO8ZeWOSlIQfWFlxbzLZe7hwFURr0= github.com/mailru/easyjson v0.7.7/go.mod h1:xzfreul335JAWq5oZzymOObrkdz5UnU4kGfJJLY9Nlc= -github.com/mattn/go-colorable v0.1.13 h1:fFA4WZxdEF4tXPZVKMLwD8oUnCTTo08duU7wxecdEvA= github.com/mattn/go-colorable v0.1.13/go.mod h1:7S9/ev0klgBDR4GtXTXX8a3vIGJpMovkB8vQcUbaXHg= github.com/mattn/go-colorable v0.1.14 h1:9A9LHSqF/7dyVVX6g0U9cwm9pG3kP9gSzcuIPHPsaIE= github.com/mattn/go-colorable v0.1.14/go.mod h1:6LmQG8QLFO4G5z1gPvYEzlUgJ2wF+stgPZH1UqBm1s8= github.com/mattn/go-isatty v0.0.16/go.mod h1:kYGgaQfpe5nmfYZH+SKPsOc2e4SrIfOl2e/yFXSvRLM= -github.com/mattn/go-isatty v0.0.19 h1:JITubQf0MOLdlGRuRq+jtsDlekdYPia9ZFsB8h/APPA= github.com/mattn/go-isatty v0.0.19/go.mod h1:W+V8PltTTMOvKvAeJH7IuucS94S2C6jfK/D7dTCTo3Y= github.com/mattn/go-isatty v0.0.20 h1:xfD0iDuEKnDkl03q4limB+vH+GxLEtL/jb4xVJSWWEY= github.com/mattn/go-isatty v0.0.20/go.mod h1:W+V8PltTTMOvKvAeJH7IuucS94S2C6jfK/D7dTCTo3Y= -github.com/mattn/go-runewidth v0.0.16 h1:E5ScNMtiwvlvB5paMFdw9p4kSQzbXFikJ5SQO6TULQc= -github.com/mattn/go-runewidth v0.0.16/go.mod h1:Jdepj2loyihRzMpdS35Xk/zdY8IAYHsh153qUoGf23w= github.com/mattn/go-runewidth v0.0.20 h1:WcT52H91ZUAwy8+HUkdM3THM6gXqXuLJi9O3rjcQQaQ= github.com/mattn/go-runewidth v0.0.20/go.mod h1:XBkDxAl56ILZc9knddidhrOlY5R/pDhgLpndooCuJAs= github.com/mitchellh/go-homedir v1.1.0 h1:lukF9ziXFxDFPkA1vsr5zpc1XuPDn/wFntq5mG+4E0Y= github.com/mitchellh/go-homedir v1.1.0/go.mod h1:SfyaCUpYCn1Vlf4IUYiD9fPX4A5wJrkLzIz1N1q0pr0= -github.com/mitchellh/go-testing-interface v1.14.1 h1:jrgshOhYAUVNMAJiKbEu7EqAwgJJ2JqpQmpLJOu07cU= -github.com/mitchellh/go-testing-interface v1.14.1/go.mod h1:gfgS7OtZj6MA4U1UrDRp04twqAjfvlZyCfX3sDjEym8= -github.com/mitchellh/mapstructure v1.5.0 h1:jeMsZIYE/09sWLaz43PL7Gy6RuMjD2eJVyuac5Z2hdY= -github.com/mitchellh/mapstructure v1.5.0/go.mod h1:bFUtVrKA4DC2yAKiSyO/QUcy7e+RRV2QTWOzhPopBRo= github.com/mohae/deepcopy v0.0.0-20170929034955-c48cc78d4826 h1:RWengNIwukTxcDr9M+97sNutRR1RKhG96O6jWumTTnw= github.com/mohae/deepcopy v0.0.0-20170929034955-c48cc78d4826/go.mod h1:TaXosZuwdSHYgviHp1DAtfrULt5eUgsSMsZf+YrPgl8= -github.com/oasdiff/yaml v0.0.0-20250309154309-f31be36b4037 h1:G7ERwszslrBzRxj//JalHPu/3yz+De2J+4aLtSRlHiY= -github.com/oasdiff/yaml v0.0.0-20250309154309-f31be36b4037/go.mod h1:2bpvgLBZEtENV5scfDFEtB/5+1M4hkQhDQrccEJ/qGw= -github.com/oasdiff/yaml3 v0.0.0-20250309153720-d2182401db90 h1:bQx3WeLcUWy+RletIKwUIt4x3t8n2SxavmoclizMb8c= -github.com/oasdiff/yaml3 v0.0.0-20250309153720-d2182401db90/go.mod h1:y5+oSEHCPT/DGrS++Wc/479ERge0zTFxaF8PbGKcg2o= +github.com/oasdiff/yaml v0.0.9 h1:zQOvd2UKoozsSsAknnWoDJlSK4lC0mpmjfDsfqNwX48= +github.com/oasdiff/yaml v0.0.9/go.mod h1:8lvhgJG4xiKPj3HN5lDow4jZHPlx1i7dIwzkdAo6oAM= +github.com/oasdiff/yaml3 v0.0.12 h1:75urAtPeDg2/iDEWwzNrLOWxI9N/dCh81nTTJtokt2M= +github.com/oasdiff/yaml3 v0.0.12/go.mod h1:y5+oSEHCPT/DGrS++Wc/479ERge0zTFxaF8PbGKcg2o= github.com/perimeterx/marshmallow v1.1.5 h1:a2LALqQ1BlHM8PZblsDdidgv1mWi1DgC2UmX50IvK2s= github.com/perimeterx/marshmallow v1.1.5/go.mod h1:dsXbUu8CRzfYP5a87xpp0xq9S3u0Vchtcl8we9tYaXw= github.com/pkg/errors v0.9.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0= github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM= github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= -github.com/rivo/uniseg v0.2.0/go.mod h1:J6wj4VEh+S6ZtnVlnTBMWIodfgj8LQOQFoIToxlJtxc= -github.com/rivo/uniseg v0.4.7 h1:WUdvkW8uEhrYfLC4ZzdpI2ztxP1I582+49Oc5Mq64VQ= -github.com/rivo/uniseg v0.4.7/go.mod h1:FN3SvrM+Zdj16jyLfmOkMNblXMcoc8DfTHruCPUcx88= github.com/rogpeppe/go-internal v1.12.0 h1:exVL4IDcn6na9z1rAb56Vxr+CgyK3nn3O+epU5NdKM8= github.com/rogpeppe/go-internal v1.12.0/go.mod h1:E+RYuTGaKKdloAfM02xzb0FW3Paa99yedzYV+kq4uf4= github.com/rs/xid v1.6.0/go.mod h1:7XoLgs4eV+QndskICGsho+ADou8ySMSjJKDIan90Nz0= github.com/rs/zerolog v1.34.0 h1:k43nTLIwcTVQAncfCw4KZ2VY6ukYoZaBPNOE8txlOeY= github.com/rs/zerolog v1.34.0/go.mod h1:bJsvje4Z08ROH4Nhs5iH600c3IkWhwp44iRc54W6wYQ= -github.com/shoenig/test v1.7.1 h1:UJcjSAI3aUKx52kfcfhblgyhZceouhvvs3OYdWgn+PY= -github.com/shoenig/test v1.7.1/go.mod h1:UxJ6u/x2v/TNs/LoLxBNJRV9DiwBBKYxXSyczsBHFoI= +github.com/santhosh-tekuri/jsonschema/v6 v6.0.2 h1:KRzFb2m7YtdldCEkzs6KqmJw4nqEVZGK7IN2kJkjTuQ= +github.com/santhosh-tekuri/jsonschema/v6 v6.0.2/go.mod h1:JXeL+ps8p7/KNMjDQk3TCwPpBy0wYklyWTfbkIzdIFU= github.com/shoenig/test v1.12.2 h1:ZVT8NeIUwGWpZcKaepPmFMoNQ3sVpxvqUh/MAqwFiJI= +github.com/shoenig/test v1.12.2/go.mod h1:UxJ6u/x2v/TNs/LoLxBNJRV9DiwBBKYxXSyczsBHFoI= github.com/stretchr/testify v1.11.1 h1:7s2iGBzp5EwR7/aIZr8ao5+dra3wiQyKjjFuvgVKu7U= github.com/stretchr/testify v1.11.1/go.mod h1:wZwfW3scLgRK+23gO65QZefKpKQRnfz6sD981Nm4B6U= github.com/ugorji/go/codec v1.2.7 h1:YPXUKf7fYbp/y8xloBqZOw2qaVggbfwMlI8WM3wZUJ0= @@ -109,12 +93,8 @@ github.com/woodsbury/decimal128 v1.3.0/go.mod h1:C5UTmyTjW3JftjUFzOVhC20BEQa2a4Z golang.org/x/sys v0.0.0-20220811171246-fbc7d0a398ab/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.6.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.12.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= -golang.org/x/sys v0.31.0 h1:ioabZlmFYtWhL+TRYpcnNlLwhyxaM9kWTDEmfnprqik= -golang.org/x/sys v0.31.0/go.mod h1:BJP2sWEmIv4KK5OTEluFJCKSidICx8ciO85XgH3Ak8k= golang.org/x/sys v0.41.0 h1:Ivj+2Cp/ylzLiEU89QhWblYnOE9zerudt9Ftecq2C6k= golang.org/x/sys v0.41.0/go.mod h1:OgkHotnGiDImocRcuBABYBEXf8A9a87e/uXjp9XT3ks= -golang.org/x/text v0.23.0 h1:D71I7dUrlY+VX0gQShAThNGHFxZ13dGLBHQLVl1mJlY= -golang.org/x/text v0.23.0/go.mod h1:/BLNzu4aZCJ1+kcD0DNRotWKage4q2rGVAg4o22unh4= golang.org/x/text v0.34.0 h1:oL/Qq0Kdaqxa1KbNeMKwQq0reLCCaFtqu2eNuSeNHbk= golang.org/x/text v0.34.0/go.mod h1:homfLqTYRFyVYemLBFl5GgL/DWEiH5wcsQ5gSh1yziA= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/callback.go b/vendor/github.com/getkin/kin-openapi/openapi3/callback.go index 31f4e4b..6d1a239 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/callback.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/callback.go @@ -2,14 +2,13 @@ package openapi3 import ( "context" - "sort" ) // Callback is specified by OpenAPI/Swagger standard version 3. // See https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.0.3.md#callback-object type Callback struct { Extensions map[string]any `json:"-" yaml:"-"` - Origin *Origin `json:"__origin__,omitempty" yaml:"__origin__,omitempty"` + Origin *Origin `json:"-" yaml:"-"` m map[string]*PathItem } @@ -39,12 +38,7 @@ func WithCallback(cb string, pathItem *PathItem) NewCallbackOption { func (callback *Callback) Validate(ctx context.Context, opts ...ValidationOption) error { ctx = WithValidationOptions(ctx, opts...) - keys := make([]string, 0, callback.Len()) - for key := range callback.Map() { - keys = append(keys, key) - } - sort.Strings(keys) - for _, key := range keys { + for _, key := range callback.Keys() { v := callback.Value(key) if err := v.Validate(ctx); err != nil { return err @@ -56,6 +50,6 @@ func (callback *Callback) Validate(ctx context.Context, opts ...ValidationOption // UnmarshalJSON sets Callbacks to a copy of data. func (callbacks *Callbacks) UnmarshalJSON(data []byte) (err error) { - *callbacks, _, err = unmarshalStringMapP[CallbackRef](data) + *callbacks, err = unmarshalStringMapP[CallbackRef](data) return } diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/components.go b/vendor/github.com/getkin/kin-openapi/openapi3/components.go index 890671a..b1109a9 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/components.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/components.go @@ -4,28 +4,26 @@ import ( "context" "encoding/json" "fmt" - "sort" + "maps" "github.com/go-openapi/jsonpointer" ) -type ( - Callbacks map[string]*CallbackRef - Examples map[string]*ExampleRef - Headers map[string]*HeaderRef - Links map[string]*LinkRef - ParametersMap map[string]*ParameterRef - RequestBodies map[string]*RequestBodyRef - ResponseBodies map[string]*ResponseRef - Schemas map[string]*SchemaRef - SecuritySchemes map[string]*SecuritySchemeRef -) +type Callbacks map[string]*CallbackRef // Callbacks represents components' named callbacks +type Examples map[string]*ExampleRef // Examples represents components' named examples +type Headers map[string]*HeaderRef // Headers represents components' named headers +type Links map[string]*LinkRef // Links represents components' named links +type ParametersMap map[string]*ParameterRef // ParametersMap represents components' named parameters +type RequestBodies map[string]*RequestBodyRef // RequestBodies represents components' named request bodies +type ResponseBodies map[string]*ResponseRef // ResponseBodies represents components' named response bodies +type Schemas map[string]*SchemaRef // Schemas represents components' named schemas +type SecuritySchemes map[string]*SecuritySchemeRef // SecuritySchemes represents components' named security schemes // Components is specified by OpenAPI/Swagger standard version 3. // See https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.0.3.md#components-object type Components struct { Extensions map[string]any `json:"-" yaml:"-"` - Origin *Origin `json:"__origin__,omitempty" yaml:"__origin__,omitempty"` + Origin *Origin `json:"-" yaml:"-"` Schemas Schemas `json:"schemas,omitempty" yaml:"schemas,omitempty"` Parameters ParametersMap `json:"parameters,omitempty" yaml:"parameters,omitempty"` @@ -54,9 +52,7 @@ func (components Components) MarshalJSON() ([]byte, error) { // MarshalYAML returns the YAML encoding of Components. func (components Components) MarshalYAML() (any, error) { m := make(map[string]any, 9+len(components.Extensions)) - for k, v := range components.Extensions { - m[k] = v - } + maps.Copy(m, components.Extensions) if x := components.Schemas; len(x) != 0 { m["schemas"] = x } @@ -95,7 +91,6 @@ func (components *Components) UnmarshalJSON(data []byte) error { return unmarshalError(err) } _ = json.Unmarshal(data, &x.Extensions) - delete(x.Extensions, originKey) delete(x.Extensions, "schemas") delete(x.Extensions, "parameters") delete(x.Extensions, "headers") @@ -116,12 +111,7 @@ func (components *Components) UnmarshalJSON(data []byte) error { func (components *Components) Validate(ctx context.Context, opts ...ValidationOption) (err error) { ctx = WithValidationOptions(ctx, opts...) - schemas := make([]string, 0, len(components.Schemas)) - for name := range components.Schemas { - schemas = append(schemas, name) - } - sort.Strings(schemas) - for _, k := range schemas { + for _, k := range componentNames(components.Schemas) { v := components.Schemas[k] if err = ValidateIdentifier(k); err != nil { return fmt.Errorf("schema %q: %w", k, err) @@ -131,12 +121,7 @@ func (components *Components) Validate(ctx context.Context, opts ...ValidationOp } } - parameters := make([]string, 0, len(components.Parameters)) - for name := range components.Parameters { - parameters = append(parameters, name) - } - sort.Strings(parameters) - for _, k := range parameters { + for _, k := range componentNames(components.Parameters) { v := components.Parameters[k] if err = ValidateIdentifier(k); err != nil { return fmt.Errorf("parameter %q: %w", k, err) @@ -146,12 +131,7 @@ func (components *Components) Validate(ctx context.Context, opts ...ValidationOp } } - requestBodies := make([]string, 0, len(components.RequestBodies)) - for name := range components.RequestBodies { - requestBodies = append(requestBodies, name) - } - sort.Strings(requestBodies) - for _, k := range requestBodies { + for _, k := range componentNames(components.RequestBodies) { v := components.RequestBodies[k] if err = ValidateIdentifier(k); err != nil { return fmt.Errorf("request body %q: %w", k, err) @@ -161,12 +141,7 @@ func (components *Components) Validate(ctx context.Context, opts ...ValidationOp } } - responses := make([]string, 0, len(components.Responses)) - for name := range components.Responses { - responses = append(responses, name) - } - sort.Strings(responses) - for _, k := range responses { + for _, k := range componentNames(components.Responses) { if err = ValidateIdentifier(k); err != nil { return fmt.Errorf("response %q: %w", k, err) } @@ -176,12 +151,7 @@ func (components *Components) Validate(ctx context.Context, opts ...ValidationOp } } - headers := make([]string, 0, len(components.Headers)) - for name := range components.Headers { - headers = append(headers, name) - } - sort.Strings(headers) - for _, k := range headers { + for _, k := range componentNames(components.Headers) { v := components.Headers[k] if err = ValidateIdentifier(k); err != nil { return fmt.Errorf("header %q: %w", k, err) @@ -191,12 +161,7 @@ func (components *Components) Validate(ctx context.Context, opts ...ValidationOp } } - securitySchemes := make([]string, 0, len(components.SecuritySchemes)) - for name := range components.SecuritySchemes { - securitySchemes = append(securitySchemes, name) - } - sort.Strings(securitySchemes) - for _, k := range securitySchemes { + for _, k := range componentNames(components.SecuritySchemes) { v := components.SecuritySchemes[k] if err = ValidateIdentifier(k); err != nil { return fmt.Errorf("security scheme %q: %w", k, err) @@ -206,12 +171,7 @@ func (components *Components) Validate(ctx context.Context, opts ...ValidationOp } } - examples := make([]string, 0, len(components.Examples)) - for name := range components.Examples { - examples = append(examples, name) - } - sort.Strings(examples) - for _, k := range examples { + for _, k := range componentNames(components.Examples) { v := components.Examples[k] if err = ValidateIdentifier(k); err != nil { return fmt.Errorf("example %q: %w", k, err) @@ -221,12 +181,7 @@ func (components *Components) Validate(ctx context.Context, opts ...ValidationOp } } - links := make([]string, 0, len(components.Links)) - for name := range components.Links { - links = append(links, name) - } - sort.Strings(links) - for _, k := range links { + for _, k := range componentNames(components.Links) { v := components.Links[k] if err = ValidateIdentifier(k); err != nil { return fmt.Errorf("link %q: %w", k, err) @@ -236,12 +191,7 @@ func (components *Components) Validate(ctx context.Context, opts ...ValidationOp } } - callbacks := make([]string, 0, len(components.Callbacks)) - for name := range components.Callbacks { - callbacks = append(callbacks, name) - } - sort.Strings(callbacks) - for _, k := range callbacks { + for _, k := range componentNames(components.Callbacks) { v := components.Callbacks[k] if err = ValidateIdentifier(k); err != nil { return fmt.Errorf("callback %q: %w", k, err) diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/contact.go b/vendor/github.com/getkin/kin-openapi/openapi3/contact.go index 2ade3c6..e6b400f 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/contact.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/contact.go @@ -3,13 +3,14 @@ package openapi3 import ( "context" "encoding/json" + "maps" ) // Contact is specified by OpenAPI/Swagger standard version 3. // See https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.0.3.md#contact-object type Contact struct { Extensions map[string]any `json:"-" yaml:"-"` - Origin *Origin `json:"__origin__,omitempty" yaml:"__origin__,omitempty"` + Origin *Origin `json:"-" yaml:"-"` Name string `json:"name,omitempty" yaml:"name,omitempty"` URL string `json:"url,omitempty" yaml:"url,omitempty"` @@ -28,9 +29,7 @@ func (contact Contact) MarshalJSON() ([]byte, error) { // MarshalYAML returns the YAML encoding of Contact. func (contact Contact) MarshalYAML() (any, error) { m := make(map[string]any, 3+len(contact.Extensions)) - for k, v := range contact.Extensions { - m[k] = v - } + maps.Copy(m, contact.Extensions) if x := contact.Name; x != "" { m["name"] = x } @@ -52,7 +51,6 @@ func (contact *Contact) UnmarshalJSON(data []byte) error { } _ = json.Unmarshal(data, &x.Extensions) - delete(x.Extensions, originKey) delete(x.Extensions, "name") delete(x.Extensions, "url") delete(x.Extensions, "email") diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/content.go b/vendor/github.com/getkin/kin-openapi/openapi3/content.go index 73e301e..8bf7921 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/content.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/content.go @@ -2,7 +2,6 @@ package openapi3 import ( "context" - "sort" "strings" ) @@ -10,7 +9,7 @@ import ( type Content map[string]*MediaType func NewContent() Content { - return make(map[string]*MediaType) + return make(Content) } func NewContentWithSchema(schema *Schema, consumes []string) Content { @@ -109,14 +108,8 @@ func (content Content) Get(mime string) *MediaType { func (content Content) Validate(ctx context.Context, opts ...ValidationOption) error { ctx = WithValidationOptions(ctx, opts...) - keys := make([]string, 0, len(content)) - for key := range content { - keys = append(keys, key) - } - sort.Strings(keys) - for _, k := range keys { - v := content[k] - if err := v.Validate(ctx); err != nil { + for _, k := range componentNames(content) { + if err := content[k].Validate(ctx); err != nil { return err } } @@ -125,6 +118,6 @@ func (content Content) Validate(ctx context.Context, opts ...ValidationOption) e // UnmarshalJSON sets Content to a copy of data. func (content *Content) UnmarshalJSON(data []byte) (err error) { - *content, _, err = unmarshalStringMapP[MediaType](data) + *content, err = unmarshalStringMapP[MediaType](data) return } diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/discriminator.go b/vendor/github.com/getkin/kin-openapi/openapi3/discriminator.go index 6934c17..e4d68f9 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/discriminator.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/discriminator.go @@ -3,16 +3,31 @@ package openapi3 import ( "context" "encoding/json" + "maps" ) // Discriminator is specified by OpenAPI/Swagger standard version 3. // See https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.0.3.md#discriminator-object type Discriminator struct { Extensions map[string]any `json:"-" yaml:"-"` - Origin *Origin `json:"__origin__,omitempty" yaml:"__origin__,omitempty"` + Origin *Origin `json:"-" yaml:"-"` - PropertyName string `json:"propertyName" yaml:"propertyName"` // required - Mapping StringMap `json:"mapping,omitempty" yaml:"mapping,omitempty"` + PropertyName string `json:"propertyName" yaml:"propertyName"` // required + Mapping StringMap[MappingRef] `json:"mapping,omitempty" yaml:"mapping,omitempty"` +} + +// MappingRef is a ref to a Schema objects. Unlike SchemaRefs it is serialised +// as a plain string instead of an object with a $ref key, as such it also does +// not support extensions. +type MappingRef SchemaRef + +func (mr *MappingRef) UnmarshalText(data []byte) error { + mr.Ref = string(data) + return nil +} + +func (mr MappingRef) MarshalText() ([]byte, error) { + return []byte(mr.Ref), nil } // MarshalJSON returns the JSON encoding of Discriminator. @@ -27,9 +42,7 @@ func (discriminator Discriminator) MarshalJSON() ([]byte, error) { // MarshalYAML returns the YAML encoding of Discriminator. func (discriminator Discriminator) MarshalYAML() (any, error) { m := make(map[string]any, 2+len(discriminator.Extensions)) - for k, v := range discriminator.Extensions { - m[k] = v - } + maps.Copy(m, discriminator.Extensions) m["propertyName"] = discriminator.PropertyName if x := discriminator.Mapping; len(x) != 0 { m["mapping"] = x @@ -46,7 +59,6 @@ func (discriminator *Discriminator) UnmarshalJSON(data []byte) error { } _ = json.Unmarshal(data, &x.Extensions) - delete(x.Extensions, originKey) delete(x.Extensions, "propertyName") delete(x.Extensions, "mapping") if len(x.Extensions) == 0 { diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/doc.go b/vendor/github.com/getkin/kin-openapi/openapi3/doc.go index 41c9965..4179030 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/doc.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/doc.go @@ -1,4 +1,25 @@ // Package openapi3 parses and writes OpenAPI 3 specification documents. // -// See https://github.com/OAI/OpenAPI-Specification/blob/master/versions/3.0.3.md +// Supports both OpenAPI 3.0 and OpenAPI 3.1: +// - OpenAPI 3.0.x: https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.0.3.md +// - OpenAPI 3.1.x: https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.1.0.md +// +// OpenAPI 3.1 Features: +// - Type arrays with null support (e.g., ["string", "null"]) +// - JSON Schema 2020-12 keywords (const, examples, prefixItems, etc.) +// - Webhooks for defining callback operations +// - JSON Schema dialect specification +// - SPDX license identifiers +// +// The implementation maintains 100% backward compatibility with OpenAPI 3.0. +// +// For OpenAPI 3.1 validation, use the JSON Schema 2020-12 validator option: +// +// schema.VisitJSON(value, openapi3.EnableJSONSchema2020()) +// +// Version detection is available via helper methods: +// +// if doc.IsOpenAPI31OrLater() { +// // Handle OpenAPI 3.1 specific features +// } package openapi3 diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/encoding.go b/vendor/github.com/getkin/kin-openapi/openapi3/encoding.go index 113eb73..d5489ac 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/encoding.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/encoding.go @@ -4,14 +4,14 @@ import ( "context" "encoding/json" "fmt" - "sort" + "maps" ) // Encoding is specified by OpenAPI/Swagger 3.0 standard. // See https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.0.3.md#encoding-object type Encoding struct { Extensions map[string]any `json:"-" yaml:"-"` - Origin *Origin `json:"__origin__,omitempty" yaml:"__origin__,omitempty"` + Origin *Origin `json:"-" yaml:"-"` ContentType string `json:"contentType,omitempty" yaml:"contentType,omitempty"` Headers Headers `json:"headers,omitempty" yaml:"headers,omitempty"` @@ -24,6 +24,15 @@ func NewEncoding() *Encoding { return &Encoding{} } +// Encodings is a map of encoding objects keyed by field name. +type Encodings map[string]*Encoding + +// UnmarshalJSON sets Encodings to a copy of data. +func (encodings *Encodings) UnmarshalJSON(data []byte) (err error) { + *encodings, err = unmarshalStringMapP[Encoding](data) + return +} + func (encoding *Encoding) WithHeader(name string, header *Header) *Encoding { return encoding.WithHeaderRef(name, &HeaderRef{ Value: header, @@ -52,9 +61,7 @@ func (encoding Encoding) MarshalJSON() ([]byte, error) { // MarshalYAML returns the YAML encoding of Encoding. func (encoding Encoding) MarshalYAML() (any, error) { m := make(map[string]any, 5+len(encoding.Extensions)) - for k, v := range encoding.Extensions { - m[k] = v - } + maps.Copy(m, encoding.Extensions) if x := encoding.ContentType; x != "" { m["contentType"] = x } @@ -82,7 +89,6 @@ func (encoding *Encoding) UnmarshalJSON(data []byte) error { } _ = json.Unmarshal(data, &x.Extensions) - delete(x.Extensions, originKey) delete(x.Extensions, "contentType") delete(x.Extensions, "headers") delete(x.Extensions, "style") @@ -118,12 +124,7 @@ func (encoding *Encoding) Validate(ctx context.Context, opts ...ValidationOption return nil } - headers := make([]string, 0, len(encoding.Headers)) - for k := range encoding.Headers { - headers = append(headers, k) - } - sort.Strings(headers) - for _, k := range headers { + for _, k := range componentNames(encoding.Headers) { v := encoding.Headers[k] if err := ValidateIdentifier(k); err != nil { return nil diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/example.go b/vendor/github.com/getkin/kin-openapi/openapi3/example.go index 44d5777..230a7bf 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/example.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/example.go @@ -4,13 +4,14 @@ import ( "context" "encoding/json" "errors" + "maps" ) // Example is specified by OpenAPI/Swagger 3.0 standard. // See https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.0.3.md#example-object type Example struct { Extensions map[string]any `json:"-" yaml:"-"` - Origin *Origin `json:"__origin__,omitempty" yaml:"__origin__,omitempty"` + Origin *Origin `json:"-" yaml:"-"` Summary string `json:"summary,omitempty" yaml:"summary,omitempty"` Description string `json:"description,omitempty" yaml:"description,omitempty"` @@ -34,9 +35,7 @@ func (example Example) MarshalJSON() ([]byte, error) { // MarshalYAML returns the YAML encoding of Example. func (example Example) MarshalYAML() (any, error) { m := make(map[string]any, 4+len(example.Extensions)) - for k, v := range example.Extensions { - m[k] = v - } + maps.Copy(m, example.Extensions) if x := example.Summary; x != "" { m["summary"] = x } @@ -60,7 +59,6 @@ func (example *Example) UnmarshalJSON(data []byte) error { return unmarshalError(err) } _ = json.Unmarshal(data, &x.Extensions) - delete(x.Extensions, originKey) delete(x.Extensions, "summary") delete(x.Extensions, "description") delete(x.Extensions, "value") @@ -88,6 +86,6 @@ func (example *Example) Validate(ctx context.Context, opts ...ValidationOption) // UnmarshalJSON sets Examples to a copy of data. func (examples *Examples) UnmarshalJSON(data []byte) (err error) { - *examples, _, err = unmarshalStringMapP[ExampleRef](data) + *examples, err = unmarshalStringMapP[ExampleRef](data) return } diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/example_validation.go b/vendor/github.com/getkin/kin-openapi/openapi3/example_validation.go index 0d105c9..1ecdcf3 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/example_validation.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/example_validation.go @@ -3,14 +3,18 @@ package openapi3 import "context" func validateExampleValue(ctx context.Context, input any, schema *Schema) error { - opts := make([]SchemaValidationOption, 0, 2) + opts := []SchemaValidationOption{MultiErrors()} - if vo := getValidationOptions(ctx); vo.examplesValidationAsReq { + vo := getValidationOptions(ctx) + if vo.examplesValidationAsReq { opts = append(opts, VisitAsRequest()) } else if vo.examplesValidationAsRes { opts = append(opts, VisitAsResponse()) } - opts = append(opts, MultiErrors()) + + if vo.jsonSchema2020ValidationEnabled { + opts = append(opts, EnableJSONSchema2020()) + } return schema.VisitJSON(input, opts...) } diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/extension.go b/vendor/github.com/getkin/kin-openapi/openapi3/extension.go index ca86078..9a3b14c 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/extension.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/extension.go @@ -3,7 +3,6 @@ package openapi3 import ( "context" "fmt" - "sort" "strings" ) @@ -11,7 +10,7 @@ func validateExtensions(ctx context.Context, extensions map[string]any) error { allowed := getValidationOptions(ctx).extraSiblingFieldsAllowed var unknowns []string - for k := range extensions { + for _, k := range componentNames(extensions) { if strings.HasPrefix(k, "x-") { continue } @@ -24,7 +23,6 @@ func validateExtensions(ctx context.Context, extensions map[string]any) error { } if len(unknowns) != 0 { - sort.Strings(unknowns) return fmt.Errorf("extra sibling fields: %+v", unknowns) } diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/external_docs.go b/vendor/github.com/getkin/kin-openapi/openapi3/external_docs.go index 7ff435f..e10973a 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/external_docs.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/external_docs.go @@ -5,6 +5,7 @@ import ( "encoding/json" "errors" "fmt" + "maps" "net/url" ) @@ -12,7 +13,7 @@ import ( // See https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.0.3.md#external-documentation-object type ExternalDocs struct { Extensions map[string]any `json:"-" yaml:"-"` - Origin *Origin `json:"__origin__,omitempty" yaml:"__origin__,omitempty"` + Origin *Origin `json:"-" yaml:"-"` Description string `json:"description,omitempty" yaml:"description,omitempty"` URL string `json:"url,omitempty" yaml:"url,omitempty"` @@ -30,9 +31,7 @@ func (e ExternalDocs) MarshalJSON() ([]byte, error) { // MarshalYAML returns the YAML encoding of ExternalDocs. func (e ExternalDocs) MarshalYAML() (any, error) { m := make(map[string]any, 2+len(e.Extensions)) - for k, v := range e.Extensions { - m[k] = v - } + maps.Copy(m, e.Extensions) if x := e.Description; x != "" { m["description"] = x } @@ -50,7 +49,6 @@ func (e *ExternalDocs) UnmarshalJSON(data []byte) error { return unmarshalError(err) } _ = json.Unmarshal(data, &x.Extensions) - delete(x.Extensions, originKey) delete(x.Extensions, "description") delete(x.Extensions, "url") if len(x.Extensions) == 0 { diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/header.go b/vendor/github.com/getkin/kin-openapi/openapi3/header.go index 6b23db5..a37bcc4 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/header.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/header.go @@ -97,6 +97,6 @@ func (header *Header) Validate(ctx context.Context, opts ...ValidationOption) er // UnmarshalJSON sets Headers to a copy of data. func (headers *Headers) UnmarshalJSON(data []byte) (err error) { - *headers, _, err = unmarshalStringMapP[HeaderRef](data) + *headers, err = unmarshalStringMapP[HeaderRef](data) return } diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/helpers.go b/vendor/github.com/getkin/kin-openapi/openapi3/helpers.go index b36b0b7..ff24c94 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/helpers.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/helpers.go @@ -6,7 +6,7 @@ import ( "path" "reflect" "regexp" - "sort" + "slices" "strings" "github.com/go-openapi/jsonpointer" @@ -31,46 +31,13 @@ func ValidateIdentifier(value string) error { return fmt.Errorf("identifier %q is not supported by OpenAPIv3 standard (charset: [%q])", value, identifierChars) } -// Ptr is a helper for defining OpenAPI schemas. -func Ptr[T any](value T) *T { - return &value -} - -// Float64Ptr is a helper for defining OpenAPI schemas. -// -// Deprecated: Use Ptr instead. -func Float64Ptr(value float64) *float64 { - return &value -} - -// BoolPtr is a helper for defining OpenAPI schemas. -// -// Deprecated: Use Ptr instead. -func BoolPtr(value bool) *bool { - return &value -} - -// Int64Ptr is a helper for defining OpenAPI schemas. -// -// Deprecated: Use Ptr instead. -func Int64Ptr(value int64) *int64 { - return &value -} - -// Uint64Ptr is a helper for defining OpenAPI schemas. -// -// Deprecated: Use Ptr instead. -func Uint64Ptr(value uint64) *uint64 { - return &value -} - // componentNames returns the map keys in a sorted slice. func componentNames[E any](s map[string]E) []string { out := make([]string, 0, len(s)) for i := range s { out = append(out, i) } - sort.Strings(out) + slices.Sort(out) return out } @@ -230,7 +197,8 @@ func ReferencesComponentInRootDocument(doc *T, ref ComponentRef) (string, bool) // Case 2: // Something like: ../openapi.yaml#/components/schemas/myElement - for name, s := range components { + for _, name := range componentNames(components) { + s := components[name] // Must be a reference to a YAML file. if !isWholeDocumentReference(s.RefString()) { continue diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/info.go b/vendor/github.com/getkin/kin-openapi/openapi3/info.go index ed5710e..7aa4a79 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/info.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/info.go @@ -4,15 +4,18 @@ import ( "context" "encoding/json" "errors" + "maps" ) // Info is specified by OpenAPI/Swagger standard version 3. // See https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.0.3.md#info-object +// and https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.1.0.md#info-object type Info struct { Extensions map[string]any `json:"-" yaml:"-"` - Origin *Origin `json:"__origin__,omitempty" yaml:"__origin__,omitempty"` + Origin *Origin `json:"-" yaml:"-"` - Title string `json:"title" yaml:"title"` // Required + Title string `json:"title" yaml:"title"` // Required + Summary string `json:"summary,omitempty" yaml:"summary,omitempty"` // OpenAPI >=3.1 Description string `json:"description,omitempty" yaml:"description,omitempty"` TermsOfService string `json:"termsOfService,omitempty" yaml:"termsOfService,omitempty"` Contact *Contact `json:"contact,omitempty" yaml:"contact,omitempty"` @@ -34,11 +37,12 @@ func (info *Info) MarshalYAML() (any, error) { if info == nil { return nil, nil } - m := make(map[string]any, 6+len(info.Extensions)) - for k, v := range info.Extensions { - m[k] = v - } + m := make(map[string]any, 7+len(info.Extensions)) + maps.Copy(m, info.Extensions) m["title"] = info.Title + if x := info.Summary; x != "" { + m["summary"] = x + } if x := info.Description; x != "" { m["description"] = x } @@ -63,8 +67,8 @@ func (info *Info) UnmarshalJSON(data []byte) error { return unmarshalError(err) } _ = json.Unmarshal(data, &x.Extensions) - delete(x.Extensions, originKey) delete(x.Extensions, "title") + delete(x.Extensions, "summary") delete(x.Extensions, "description") delete(x.Extensions, "termsOfService") delete(x.Extensions, "contact") @@ -81,6 +85,10 @@ func (info *Info) UnmarshalJSON(data []byte) error { func (info *Info) Validate(ctx context.Context, opts ...ValidationOption) error { ctx = WithValidationOptions(ctx, opts...) + if info.Summary != "" && !getValidationOptions(ctx).isOpenAPI31OrLater { + return errFieldFor31Plus("summary") + } + if contact := info.Contact; contact != nil { if err := contact.Validate(ctx); err != nil { return err diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/internalize_refs.go b/vendor/github.com/getkin/kin-openapi/openapi3/internalize_refs.go index b725baf..fe8b379 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/internalize_refs.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/internalize_refs.go @@ -6,7 +6,7 @@ import ( "strings" ) -// RefNameResolver maps a component to an name that is used as it's internalized name. +// RefNameResolver maps a component to a name that is used as it's internalized name. // // The function should avoid name collisions (i.e. be a injective mapping). // It must only contain characters valid for fixed field names: [IdentifierRegExp]. @@ -23,7 +23,7 @@ type RefNameResolver func(*T, ComponentRef) string // - Cutting the "#/components/" part. // - Cutting the file extensions (.yaml/.json) from documents. // - Trimming the common directory with the root spec. -// - Replace invalid characters with with underscores. +// - Replace invalid characters with underscores. // // This is an injective mapping over a "reasonable" amount of the possible openapi // spec domain space but is not perfect. There might be edge cases. @@ -34,7 +34,7 @@ func DefaultRefNameResolver(doc *T, ref ComponentRef) string { name := ref.RefPath() - // If refering to a component in the root spec, no need to internalize just use + // If referring to a component in the root spec, no need to internalize just use // the existing component. // XXX(percivalalb): since this function call is iterating over components behind the // scenes during an internalization call it actually starts interating over @@ -63,7 +63,7 @@ func DefaultRefNameResolver(doc *T, ref ComponentRef) string { filePath = "" } - // Remove the path extentions to make this JSON/YAML agnostic. + // Remove the path extensions to make this JSON/YAML agnostic. for ext := path.Ext(filePath); len(ext) > 0; ext = path.Ext(filePath) { filePath = strings.TrimSuffix(filePath, ext) } @@ -112,7 +112,7 @@ func cutDirectories(p, dirs string) (string, bool) { var sb strings.Builder sb.Grow(len(ParameterInHeader)) - for _, segments := range strings.Split(p, "/") { + for segments := range strings.SplitSeq(p, "/") { sb.WriteString(segments) if sb.String() == p { @@ -345,6 +345,18 @@ func (doc *T) derefSchema(s *Schema, refNameResolver RefNameResolver, parentIsEx } } + // Discriminator mapping values are special cases since they are not full + // ref objects but are string references to schema objects. + if s.Discriminator != nil { + for _, k := range componentNames(s.Discriminator.Mapping) { + mapRef := s.Discriminator.Mapping[k] + s2 := (*SchemaRef)(&mapRef) + isExternal := doc.addSchemaToSpec(s2, refNameResolver, parentIsExternal) + doc.derefSchema(s2.Value, refNameResolver, isExternal || parentIsExternal) + s.Discriminator.Mapping[k] = MappingRef(*s2) + } + } + for _, name := range componentNames(s.Properties) { s2 := s.Properties[name] isExternal := doc.addSchemaToSpec(s2, refNameResolver, parentIsExternal) diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/license.go b/vendor/github.com/getkin/kin-openapi/openapi3/license.go index eb47fc3..de86cf6 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/license.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/license.go @@ -4,16 +4,22 @@ import ( "context" "encoding/json" "errors" + "maps" ) // License is specified by OpenAPI/Swagger standard version 3. // See https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.0.3.md#license-object +// and https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.1.0.md#license-object type License struct { Extensions map[string]any `json:"-" yaml:"-"` - Origin *Origin `json:"__origin__,omitempty" yaml:"__origin__,omitempty"` + Origin *Origin `json:"-" yaml:"-"` Name string `json:"name" yaml:"name"` // Required URL string `json:"url,omitempty" yaml:"url,omitempty"` + + // Identifier is an SPDX license expression for the API (OpenAPI 3.1) + // Either url or identifier can be specified, not both + Identifier string `json:"identifier,omitempty" yaml:"identifier,omitempty"` // OpenAPI >=3.1 } // MarshalJSON returns the JSON encoding of License. @@ -27,14 +33,15 @@ func (license License) MarshalJSON() ([]byte, error) { // MarshalYAML returns the YAML encoding of License. func (license License) MarshalYAML() (any, error) { - m := make(map[string]any, 2+len(license.Extensions)) - for k, v := range license.Extensions { - m[k] = v - } + m := make(map[string]any, 3+len(license.Extensions)) + maps.Copy(m, license.Extensions) m["name"] = license.Name if x := license.URL; x != "" { m["url"] = x } + if x := license.Identifier; x != "" { + m["identifier"] = x + } return m, nil } @@ -46,9 +53,9 @@ func (license *License) UnmarshalJSON(data []byte) error { return unmarshalError(err) } _ = json.Unmarshal(data, &x.Extensions) - delete(x.Extensions, originKey) delete(x.Extensions, "name") delete(x.Extensions, "url") + delete(x.Extensions, "identifier") if len(x.Extensions) == 0 { x.Extensions = nil } @@ -60,9 +67,17 @@ func (license *License) UnmarshalJSON(data []byte) error { func (license *License) Validate(ctx context.Context, opts ...ValidationOption) error { ctx = WithValidationOptions(ctx, opts...) + if license.Identifier != "" && !getValidationOptions(ctx).isOpenAPI31OrLater { + return errFieldFor31Plus("identifier") + } + if license.Name == "" { return errors.New("value of license name must be a non-empty string") } + if license.URL != "" && license.Identifier != "" { + return errors.New("license must not specify both 'url' and 'identifier'") + } + return validateExtensions(ctx, license.Extensions) } diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/link.go b/vendor/github.com/getkin/kin-openapi/openapi3/link.go index c76cf44..2e6ecfc 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/link.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/link.go @@ -5,13 +5,14 @@ import ( "encoding/json" "errors" "fmt" + "maps" ) // Link is specified by OpenAPI/Swagger standard version 3. // See https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.0.3.md#link-object type Link struct { Extensions map[string]any `json:"-" yaml:"-"` - Origin *Origin `json:"__origin__,omitempty" yaml:"__origin__,omitempty"` + Origin *Origin `json:"-" yaml:"-"` OperationRef string `json:"operationRef,omitempty" yaml:"operationRef,omitempty"` OperationID string `json:"operationId,omitempty" yaml:"operationId,omitempty"` @@ -33,9 +34,7 @@ func (link Link) MarshalJSON() ([]byte, error) { // MarshalYAML returns the YAML encoding of Link. func (link Link) MarshalYAML() (any, error) { m := make(map[string]any, 6+len(link.Extensions)) - for k, v := range link.Extensions { - m[k] = v - } + maps.Copy(m, link.Extensions) if x := link.OperationRef; x != "" { m["operationRef"] = x @@ -68,7 +67,6 @@ func (link *Link) UnmarshalJSON(data []byte) error { } _ = json.Unmarshal(data, &x.Extensions) - delete(x.Extensions, originKey) delete(x.Extensions, "operationRef") delete(x.Extensions, "operationId") delete(x.Extensions, "description") @@ -98,6 +96,6 @@ func (link *Link) Validate(ctx context.Context, opts ...ValidationOption) error // UnmarshalJSON sets Links to a copy of data. func (links *Links) UnmarshalJSON(data []byte) (err error) { - *links, _, err = unmarshalStringMapP[LinkRef](data) + *links, err = unmarshalStringMapP[LinkRef](data) return } diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/loader.go b/vendor/github.com/getkin/kin-openapi/openapi3/loader.go index 67674fc..5df84d7 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/loader.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/loader.go @@ -15,9 +15,9 @@ import ( "strings" ) -// IncludeOrigin specifies whether to include the origin of the OpenAPI elements -// Set this to true before loading a spec to include the origin of the OpenAPI elements -// Note it is global and affects all loaders +// IncludeOrigin specifies whether to include the origin of the OpenAPI elements. +// Deprecated: set Loader.IncludeOrigin instead. This global is read by NewLoader +// for backward compatibility but is not safe for concurrent use. var IncludeOrigin = false func foundUnresolvedRef(ref string) error { @@ -33,9 +33,21 @@ type Loader struct { // IsExternalRefsAllowed enables visiting other files IsExternalRefsAllowed bool + // IncludeOrigin enables recording the file/line/column of each OpenAPI element. + // Prefer this over the package-level IncludeOrigin global, which is not safe for + // concurrent use. + IncludeOrigin bool + // ReadFromURIFunc allows overriding the any file/URL reading func ReadFromURIFunc ReadFromURIFunc + // JoinFunc allows overriding how relative $ref paths are resolved against + // a base path. When set, it is called instead of the default join logic + // that uses path.Dir and path.Join. This is useful when loading specs from + // non-filesystem sources (e.g. git objects, remote archives) where the base + // path follows a different convention than filesystem paths. + JoinFunc func(basePath *url.URL, relativePath *url.URL) *url.URL + Context context.Context rootDir string @@ -53,7 +65,8 @@ type Loader struct { // NewLoader returns an empty Loader func NewLoader() *Loader { return &Loader{ - Context: context.Background(), + Context: context.Background(), + IncludeOrigin: IncludeOrigin, } } @@ -92,11 +105,16 @@ func (loader *Loader) allowsExternalRefs(ref string) (err error) { } func (loader *Loader) loadSingleElementFromURI(ref string, rootPath *url.URL, element any) (*url.URL, error) { - if err := loader.allowsExternalRefs(ref); err != nil { - return nil, err + // When a custom ReadFromURIFunc is installed, defer the external-ref decision to it; + // the function itself is responsible for enforcing any access policy. + // Otherwise enforce IsExternalRefsAllowed here before attempting any I/O. + if loader.ReadFromURIFunc == nil { + if err := loader.allowsExternalRefs(ref); err != nil { + return nil, err + } } - resolvedPath, err := resolvePathWithRef(ref, rootPath) + resolvedPath, err := loader.resolvePathWithRef(ref, rootPath) if err != nil { return nil, err } @@ -108,7 +126,7 @@ func (loader *Loader) loadSingleElementFromURI(ref string, rootPath *url.URL, el if err != nil { return nil, err } - if err := unmarshal(data, element, IncludeOrigin); err != nil { + if err := unmarshal(data, element, loader.IncludeOrigin, resolvedPath); err != nil { return nil, err } @@ -144,7 +162,7 @@ func (loader *Loader) LoadFromIoReader(reader io.Reader) (*T, error) { func (loader *Loader) LoadFromData(data []byte) (*T, error) { loader.resetVisitedPathItemRefs() doc := &T{} - if err := unmarshal(data, doc, IncludeOrigin); err != nil { + if err := unmarshal(data, doc, loader.IncludeOrigin, nil); err != nil { return nil, err } if err := loader.ResolveRefsIn(doc, nil); err != nil { @@ -173,7 +191,7 @@ func (loader *Loader) loadFromDataWithPathInternal(data []byte, location *url.UR doc := &T{} loader.visitedDocuments[uri] = doc - if err := unmarshal(data, doc, IncludeOrigin); err != nil { + if err := unmarshal(data, doc, loader.IncludeOrigin, location); err != nil { return nil, err } @@ -259,10 +277,18 @@ func (loader *Loader) ResolveRefsIn(doc *T, location *url.URL) (err error) { } } + for _, name := range componentNames(doc.Webhooks) { + if pathItem := doc.Webhooks[name]; pathItem != nil { + if err = loader.resolvePathItemRef(doc, pathItem, location); err != nil { + return + } + } + } + return } -func join(basePath *url.URL, relativePath *url.URL) *url.URL { +func defaultJoin(basePath *url.URL, relativePath *url.URL) *url.URL { if basePath == nil { return relativePath } @@ -271,24 +297,27 @@ func join(basePath *url.URL, relativePath *url.URL) *url.URL { return &newPath } -func resolvePath(basePath *url.URL, componentPath *url.URL) *url.URL { +func (loader *Loader) resolvePath(basePath *url.URL, componentPath *url.URL) *url.URL { if is_file(componentPath) { // support absolute paths if filepath.IsAbs(componentPath.Path) { return componentPath } - return join(basePath, componentPath) + if loader.JoinFunc != nil { + return loader.JoinFunc(basePath, componentPath) + } + return defaultJoin(basePath, componentPath) } return componentPath } -func resolvePathWithRef(ref string, rootPath *url.URL) (*url.URL, error) { +func (loader *Loader) resolvePathWithRef(ref string, rootPath *url.URL) (*url.URL, error) { parsedURL, err := url.Parse(ref) if err != nil { return nil, fmt.Errorf("cannot parse reference: %q: %w", ref, err) } - resolvedPath := resolvePath(rootPath, parsedURL) + resolvedPath := loader.resolvePath(rootPath, parsedURL) resolvedPath.Fragment = parsedURL.Fragment return resolvedPath, nil } @@ -306,11 +335,14 @@ func (loader *Loader) resolveRefPath(ref string, path *url.URL) (*url.URL, error return path, nil } - if err := loader.allowsExternalRefs(ref); err != nil { - return nil, err + // When a custom ReadFromURIFunc is installed, defer the external-ref decision to it. + if loader.ReadFromURIFunc == nil { + if err := loader.allowsExternalRefs(ref); err != nil { + return nil, err + } } - resolvedPath, err := resolvePathWithRef(ref, path) + resolvedPath, err := loader.resolvePathWithRef(ref, path) if err != nil { return nil, err } @@ -372,7 +404,7 @@ func (loader *Loader) resolveComponent(doc *T, ref string, path *url.URL, resolv } drill := func(cursor any) (any, error) { - for _, pathPart := range strings.Split(fragment[1:], "/") { + for pathPart := range strings.SplitSeq(fragment[1:], "/") { pathPart = unescapeRefString(pathPart) attempted := false @@ -427,7 +459,7 @@ func (loader *Loader) resolveComponent(doc *T, ref string, path *url.URL, resolv if err2 != nil { return nil, nil, err } - if err2 = unmarshal(data, &cursor, IncludeOrigin); err2 != nil { + if err2 = unmarshal(data, &cursor, loader.IncludeOrigin, path); err2 != nil { return nil, nil, err } if cursor, err2 = drill(cursor); err2 != nil || cursor == nil { @@ -534,7 +566,7 @@ func drillIntoField(cursor any, fieldName string) (any, error) { case reflect.Struct: hasFields := false - for i := 0; i < val.NumField(); i++ { + for i := range val.NumField() { hasFields = true if yamlTag := val.Type().Field(i).Tag.Get("yaml"); yamlTag != "-" { if tagName := strings.Split(yamlTag, ",")[0]; tagName != "" { @@ -657,8 +689,8 @@ func (loader *Loader) resolveHeaderRef(doc *T, component *HeaderRef, documentPat return err } } - for _, example := range value.Examples { - if err := loader.resolveExampleRef(doc, example, documentPath); err != nil { + for _, k := range componentNames(value.Examples) { + if err := loader.resolveExampleRef(doc, value.Examples[k], documentPath); err != nil { return err } } @@ -721,8 +753,8 @@ func (loader *Loader) resolveParameterRef(doc *T, component *ParameterRef, docum return err } } - for _, example := range contentType.Examples { - if err := loader.resolveExampleRef(doc, example, documentPath); err != nil { + for _, k := range componentNames(contentType.Examples) { + if err := loader.resolveExampleRef(doc, contentType.Examples[k], documentPath); err != nil { return err } } @@ -732,8 +764,8 @@ func (loader *Loader) resolveParameterRef(doc *T, component *ParameterRef, docum return err } } - for _, example := range value.Examples { - if err := loader.resolveExampleRef(doc, example, documentPath); err != nil { + for _, k := range componentNames(value.Examples) { + if err := loader.resolveExampleRef(doc, value.Examples[k], documentPath); err != nil { return err } } @@ -927,6 +959,18 @@ func (loader *Loader) resolveSchemaRef(doc *T, component *SchemaRef, documentPat component.setRefPath(resolved.RefPath()) } defer loader.unvisitRef(ref, component.Value) + + // OAS 3.1 / JSON Schema 2020-12: apply sibling keywords from the original schema + // object on top of the resolved $ref value. In 3.1, siblings are not ignored — + // they augment the referenced schema (e.g. deprecated:true alongside $ref). + // Only apply for OAS 3.1+ — in 3.0 $ref replaces its entire object and siblings + // are (validly) ignored. + if doc.IsOpenAPI31OrLater() && component.sibling != nil && component.Value != nil { + // Work on a copy so we don't mutate a schema shared by other references. + schemaCopy := *component.Value + applySiblingSchemaFields(&schemaCopy, component.sibling, component.extra) + component.Value = &schemaCopy + } } value := component.Value if value == nil { @@ -970,6 +1014,89 @@ func (loader *Loader) resolveSchemaRef(doc *T, component *SchemaRef, documentPat return err } } + // Discriminator mapping refs are a special case since they are not full + // ref objects but are plain strings that reference schema objects. + // Only resolve refs that look like external references (contain a path). + // Plain schema names like "Dog" or internal refs like "#/components/schemas/Dog" + // don't need to be resolved by the loader. + if value.Discriminator != nil { + for _, k := range componentNames(value.Discriminator.Mapping) { + v := value.Discriminator.Mapping[k] + // Only resolve if it looks like an external ref (contains path separator) + if strings.Contains(v.Ref, "/") && !strings.HasPrefix(v.Ref, "#") { + if err := loader.resolveSchemaRef(doc, (*SchemaRef)(&v), documentPath, visited); err != nil { + return err + } + value.Discriminator.Mapping[k] = v + } + } + } + + // OpenAPI 3.1 / JSON Schema 2020-12 fields + for _, v := range value.PrefixItems { + if err := loader.resolveSchemaRef(doc, v, documentPath, visited); err != nil { + return err + } + } + if v := value.Contains; v != nil { + if err := loader.resolveSchemaRef(doc, v, documentPath, visited); err != nil { + return err + } + } + for _, name := range componentNames(value.PatternProperties) { + v := value.PatternProperties[name] + if err := loader.resolveSchemaRef(doc, v, documentPath, visited); err != nil { + return err + } + } + for _, name := range componentNames(value.DependentSchemas) { + v := value.DependentSchemas[name] + if err := loader.resolveSchemaRef(doc, v, documentPath, visited); err != nil { + return err + } + } + for _, name := range componentNames(value.Defs) { + v := value.Defs[name] + if err := loader.resolveSchemaRef(doc, v, documentPath, visited); err != nil { + return err + } + } + if v := value.PropertyNames; v != nil { + if err := loader.resolveSchemaRef(doc, v, documentPath, visited); err != nil { + return err + } + } + if v := value.UnevaluatedItems.Schema; v != nil { + if err := loader.resolveSchemaRef(doc, v, documentPath, visited); err != nil { + return err + } + } + if v := value.UnevaluatedProperties.Schema; v != nil { + if err := loader.resolveSchemaRef(doc, v, documentPath, visited); err != nil { + return err + } + } + if v := value.If; v != nil { + if err := loader.resolveSchemaRef(doc, v, documentPath, visited); err != nil { + return err + } + } + if v := value.Then; v != nil { + if err := loader.resolveSchemaRef(doc, v, documentPath, visited); err != nil { + return err + } + } + if v := value.Else; v != nil { + if err := loader.resolveSchemaRef(doc, v, documentPath, visited); err != nil { + return err + } + } + if v := value.ContentSchema; v != nil { + if err := loader.resolveSchemaRef(doc, v, documentPath, visited); err != nil { + return err + } + } + return nil } @@ -1231,3 +1358,137 @@ func (loader *Loader) resolvePathItemRef(doc *T, pathItem *PathItem, documentPat func unescapeRefString(ref string) string { return strings.ReplaceAll(strings.ReplaceAll(ref, "~1", "/"), "~0", "~") } + +// applySiblingSchemaFields overlays the fields listed in presentFields from sibling onto dst. +// It is used to honour keyword siblings of $ref in OpenAPI 3.1 / JSON Schema 2020-12, where +// sibling keywords are applied in addition to (not instead of) the referenced schema. +// Only fields that were explicitly present in the original YAML/JSON are applied; the presentFields +// slice (derived from SchemaRef.extra) carries this information. +func applySiblingSchemaFields(dst, sibling *Schema, presentFields []string) { + for _, field := range presentFields { + switch field { + case "oneOf": + dst.OneOf = sibling.OneOf + case "anyOf": + dst.AnyOf = sibling.AnyOf + case "allOf": + dst.AllOf = sibling.AllOf + case "not": + dst.Not = sibling.Not + case "type": + dst.Type = sibling.Type + case "title": + dst.Title = sibling.Title + case "format": + dst.Format = sibling.Format + case "description": + dst.Description = sibling.Description + case "enum": + dst.Enum = sibling.Enum + case "default": + dst.Default = sibling.Default + case "example": + dst.Example = sibling.Example + case "externalDocs": + dst.ExternalDocs = sibling.ExternalDocs + case "uniqueItems": + dst.UniqueItems = sibling.UniqueItems + case "exclusiveMinimum": + dst.ExclusiveMin = sibling.ExclusiveMin + case "exclusiveMaximum": + dst.ExclusiveMax = sibling.ExclusiveMax + case "nullable": + dst.Nullable = sibling.Nullable + case "readOnly": + dst.ReadOnly = sibling.ReadOnly + case "writeOnly": + dst.WriteOnly = sibling.WriteOnly + case "allowEmptyValue": + dst.AllowEmptyValue = sibling.AllowEmptyValue + case "deprecated": + dst.Deprecated = sibling.Deprecated + case "xml": + dst.XML = sibling.XML + case "minimum": + dst.Min = sibling.Min + case "maximum": + dst.Max = sibling.Max + case "multipleOf": + dst.MultipleOf = sibling.MultipleOf + case "minLength": + dst.MinLength = sibling.MinLength + case "maxLength": + dst.MaxLength = sibling.MaxLength + case "pattern": + dst.Pattern = sibling.Pattern + case "minItems": + dst.MinItems = sibling.MinItems + case "maxItems": + dst.MaxItems = sibling.MaxItems + case "items": + dst.Items = sibling.Items + case "required": + dst.Required = sibling.Required + case "properties": + dst.Properties = sibling.Properties + case "minProperties": + dst.MinProps = sibling.MinProps + case "maxProperties": + dst.MaxProps = sibling.MaxProps + case "additionalProperties": + dst.AdditionalProperties = sibling.AdditionalProperties + case "discriminator": + dst.Discriminator = sibling.Discriminator + case "const": + dst.Const = sibling.Const + case "examples": + dst.Examples = sibling.Examples + case "prefixItems": + dst.PrefixItems = sibling.PrefixItems + case "contains": + dst.Contains = sibling.Contains + case "minContains": + dst.MinContains = sibling.MinContains + case "maxContains": + dst.MaxContains = sibling.MaxContains + case "patternProperties": + dst.PatternProperties = sibling.PatternProperties + case "dependentSchemas": + dst.DependentSchemas = sibling.DependentSchemas + case "propertyNames": + dst.PropertyNames = sibling.PropertyNames + case "unevaluatedItems": + dst.UnevaluatedItems = sibling.UnevaluatedItems + case "unevaluatedProperties": + dst.UnevaluatedProperties = sibling.UnevaluatedProperties + case "if": + dst.If = sibling.If + case "then": + dst.Then = sibling.Then + case "else": + dst.Else = sibling.Else + case "dependentRequired": + dst.DependentRequired = sibling.DependentRequired + case "$defs": + dst.Defs = sibling.Defs + case "$schema": + dst.SchemaDialect = sibling.SchemaDialect + case "$comment": + dst.Comment = sibling.Comment + case "$id": + dst.SchemaID = sibling.SchemaID + case "$anchor": + dst.Anchor = sibling.Anchor + case "$dynamicRef": + dst.DynamicRef = sibling.DynamicRef + case "$dynamicAnchor": + dst.DynamicAnchor = sibling.DynamicAnchor + case "contentMediaType": + dst.ContentMediaType = sibling.ContentMediaType + case "contentEncoding": + dst.ContentEncoding = sibling.ContentEncoding + case "contentSchema": + dst.ContentSchema = sibling.ContentSchema + } + } +} diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/maplike.go b/vendor/github.com/getkin/kin-openapi/openapi3/maplike.go index 36aa244..3a97be1 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/maplike.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/maplike.go @@ -2,7 +2,7 @@ package openapi3 import ( "encoding/json" - "sort" + "maps" "strings" "github.com/go-openapi/jsonpointer" @@ -16,6 +16,11 @@ func NewResponsesWithCapacity(cap int) *Responses { return &Responses{m: make(map[string]*ResponseRef, cap)} } +// Keys returns the responses keys in a fixed order +func (responses *Responses) Keys() []string { + return componentNames(responses.Map()) +} + // Value returns the responses for key or nil func (responses *Responses) Value(key string) *ResponseRef { if responses.Len() == 0 { @@ -55,9 +60,7 @@ func (responses *Responses) Map() (m map[string]*ResponseRef) { return make(map[string]*ResponseRef) } m = make(map[string]*ResponseRef, len(responses.m)) - for k, v := range responses.m { - m[k] = v - } + maps.Copy(m, responses.m) return } @@ -81,11 +84,9 @@ func (responses *Responses) MarshalYAML() (any, error) { return nil, nil } m := make(map[string]any, responses.Len()+len(responses.Extensions)) - for k, v := range responses.Extensions { - m[k] = v - } - for k, v := range responses.Map() { - m[k] = v + maps.Copy(m, responses.Extensions) + for _, k := range responses.Keys() { + m[k] = responses.m[k] } return m, nil } @@ -106,35 +107,18 @@ func (responses *Responses) UnmarshalJSON(data []byte) (err error) { return } - ks := make([]string, 0, len(m)) - for k := range m { - ks = append(ks, k) - } - sort.Strings(ks) - x := Responses{ Extensions: make(map[string]any), m: make(map[string]*ResponseRef, len(m)), } - for _, k := range ks { + for _, k := range componentNames(m) { v := m[k] if strings.HasPrefix(k, "x-") { x.Extensions[k] = v continue } - if k == originKey { - var data []byte - if data, err = json.Marshal(v); err != nil { - return - } - if err = json.Unmarshal(data, &x.Origin); err != nil { - return - } - continue - } - var data []byte if data, err = json.Marshal(v); err != nil { return @@ -157,6 +141,11 @@ func NewCallbackWithCapacity(cap int) *Callback { return &Callback{m: make(map[string]*PathItem, cap)} } +// Keys returns the callback keys in a fixed order +func (callback *Callback) Keys() []string { + return componentNames(callback.Map()) +} + // Value returns the callback for key or nil func (callback *Callback) Value(key string) *PathItem { if callback.Len() == 0 { @@ -196,9 +185,7 @@ func (callback *Callback) Map() (m map[string]*PathItem) { return make(map[string]*PathItem) } m = make(map[string]*PathItem, len(callback.m)) - for k, v := range callback.m { - m[k] = v - } + maps.Copy(m, callback.m) return } @@ -222,11 +209,9 @@ func (callback *Callback) MarshalYAML() (any, error) { return nil, nil } m := make(map[string]any, callback.Len()+len(callback.Extensions)) - for k, v := range callback.Extensions { - m[k] = v - } - for k, v := range callback.Map() { - m[k] = v + maps.Copy(m, callback.Extensions) + for _, k := range callback.Keys() { + m[k] = callback.m[k] } return m, nil } @@ -247,35 +232,18 @@ func (callback *Callback) UnmarshalJSON(data []byte) (err error) { return } - ks := make([]string, 0, len(m)) - for k := range m { - ks = append(ks, k) - } - sort.Strings(ks) - x := Callback{ Extensions: make(map[string]any), m: make(map[string]*PathItem, len(m)), } - for _, k := range ks { + for _, k := range componentNames(m) { v := m[k] if strings.HasPrefix(k, "x-") { x.Extensions[k] = v continue } - if k == originKey { - var data []byte - if data, err = json.Marshal(v); err != nil { - return - } - if err = json.Unmarshal(data, &x.Origin); err != nil { - return - } - continue - } - var data []byte if data, err = json.Marshal(v); err != nil { return @@ -298,6 +266,11 @@ func NewPathsWithCapacity(cap int) *Paths { return &Paths{m: make(map[string]*PathItem, cap)} } +// Keys returns the paths keys in a fixed order +func (paths *Paths) Keys() []string { + return componentNames(paths.Map()) +} + // Value returns the paths for key or nil func (paths *Paths) Value(key string) *PathItem { if paths.Len() == 0 { @@ -337,9 +310,7 @@ func (paths *Paths) Map() (m map[string]*PathItem) { return make(map[string]*PathItem) } m = make(map[string]*PathItem, len(paths.m)) - for k, v := range paths.m { - m[k] = v - } + maps.Copy(m, paths.m) return } @@ -363,11 +334,9 @@ func (paths *Paths) MarshalYAML() (any, error) { return nil, nil } m := make(map[string]any, paths.Len()+len(paths.Extensions)) - for k, v := range paths.Extensions { - m[k] = v - } - for k, v := range paths.Map() { - m[k] = v + maps.Copy(m, paths.Extensions) + for _, k := range paths.Keys() { + m[k] = paths.m[k] } return m, nil } @@ -388,35 +357,18 @@ func (paths *Paths) UnmarshalJSON(data []byte) (err error) { return } - ks := make([]string, 0, len(m)) - for k := range m { - ks = append(ks, k) - } - sort.Strings(ks) - x := Paths{ Extensions: make(map[string]any), m: make(map[string]*PathItem, len(m)), } - for _, k := range ks { + for _, k := range componentNames(m) { v := m[k] if strings.HasPrefix(k, "x-") { x.Extensions[k] = v continue } - if k == originKey { - var data []byte - if data, err = json.Marshal(v); err != nil { - return - } - if err = json.Unmarshal(data, &x.Origin); err != nil { - return - } - continue - } - var data []byte if data, err = json.Marshal(v); err != nil { return diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/marsh.go b/vendor/github.com/getkin/kin-openapi/openapi3/marsh.go index 2f00828..a549070 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/marsh.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/marsh.go @@ -3,6 +3,7 @@ package openapi3 import ( "encoding/json" "fmt" + "net/url" "strings" "github.com/oasdiff/yaml" @@ -16,7 +17,7 @@ func unmarshalError(jsonUnmarshalErr error) error { return jsonUnmarshalErr } -func unmarshal(data []byte, v any, includeOrigin bool) error { +func unmarshal(data []byte, v any, includeOrigin bool, location *url.URL) error { var jsonErr, yamlErr error // See https://github.com/getkin/kin-openapi/issues/680 @@ -25,8 +26,15 @@ func unmarshal(data []byte, v any, includeOrigin bool) error { } // UnmarshalStrict(data, v) TODO: investigate how ymlv3 handles duplicate map keys - if yamlErr = yaml.UnmarshalWithOrigin(data, v, includeOrigin); yamlErr == nil { + var file string + if location != nil { + file = location.String() + } + if tree, err := yaml.UnmarshalWithOriginTree(data, v, yaml.OriginOpt{Enabled: includeOrigin, File: file}); err == nil { + applyOrigins(v, tree) return nil + } else { + yamlErr = err } // If both unmarshaling attempts fail, return a new error that includes both errors diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/media_type.go b/vendor/github.com/getkin/kin-openapi/openapi3/media_type.go index 576826f..679df0b 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/media_type.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/media_type.go @@ -5,7 +5,7 @@ import ( "encoding/json" "errors" "fmt" - "sort" + "maps" "github.com/go-openapi/jsonpointer" ) @@ -14,12 +14,12 @@ import ( // See https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.0.3.md#media-type-object type MediaType struct { Extensions map[string]any `json:"-" yaml:"-"` - Origin *Origin `json:"__origin__,omitempty" yaml:"__origin__,omitempty"` + Origin *Origin `json:"-" yaml:"-"` - Schema *SchemaRef `json:"schema,omitempty" yaml:"schema,omitempty"` - Example any `json:"example,omitempty" yaml:"example,omitempty"` - Examples Examples `json:"examples,omitempty" yaml:"examples,omitempty"` - Encoding map[string]*Encoding `json:"encoding,omitempty" yaml:"encoding,omitempty"` + Schema *SchemaRef `json:"schema,omitempty" yaml:"schema,omitempty"` + Example any `json:"example,omitempty" yaml:"example,omitempty"` + Examples Examples `json:"examples,omitempty" yaml:"examples,omitempty"` + Encoding Encodings `json:"encoding,omitempty" yaml:"encoding,omitempty"` } var _ jsonpointer.JSONPointable = (*MediaType)(nil) @@ -57,7 +57,7 @@ func (mediaType *MediaType) WithExample(name string, value any) *MediaType { func (mediaType *MediaType) WithEncoding(name string, enc *Encoding) *MediaType { encoding := mediaType.Encoding if encoding == nil { - encoding = make(map[string]*Encoding) + encoding = make(Encodings) mediaType.Encoding = encoding } encoding[name] = enc @@ -76,9 +76,7 @@ func (mediaType MediaType) MarshalJSON() ([]byte, error) { // MarshalYAML returns the YAML encoding of MediaType. func (mediaType MediaType) MarshalYAML() (any, error) { m := make(map[string]any, 4+len(mediaType.Extensions)) - for k, v := range mediaType.Extensions { - m[k] = v - } + maps.Copy(m, mediaType.Extensions) if x := mediaType.Schema; x != nil { m["schema"] = x } @@ -102,7 +100,6 @@ func (mediaType *MediaType) UnmarshalJSON(data []byte) error { return unmarshalError(err) } _ = json.Unmarshal(data, &x.Extensions) - delete(x.Extensions, originKey) delete(x.Extensions, "schema") delete(x.Extensions, "example") delete(x.Extensions, "examples") @@ -110,6 +107,7 @@ func (mediaType *MediaType) UnmarshalJSON(data []byte) error { if len(x.Extensions) == 0 { x.Extensions = nil } + delete(x.Encoding, originKey) *mediaType = MediaType(x) return nil } @@ -138,12 +136,7 @@ func (mediaType *MediaType) Validate(ctx context.Context, opts ...ValidationOpti } if examples := mediaType.Examples; examples != nil { - names := make([]string, 0, len(examples)) - for name := range examples { - names = append(names, name) - } - sort.Strings(names) - for _, k := range names { + for _, k := range componentNames(examples) { v := examples[k] if err := v.Validate(ctx); err != nil { return fmt.Errorf("example %s: %w", k, err) diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/openapi3.go b/vendor/github.com/getkin/kin-openapi/openapi3/openapi3.go index ef1592e..701ebbe 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/openapi3.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/openapi3.go @@ -5,27 +5,78 @@ import ( "encoding/json" "errors" "fmt" + "maps" "net/url" + "slices" "github.com/go-openapi/jsonpointer" ) // T is the root of an OpenAPI v3 document // See https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.0.3.md#openapi-object +// and https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.1.0.md#openapi-object type T struct { Extensions map[string]any `json:"-" yaml:"-"` - OpenAPI string `json:"openapi" yaml:"openapi"` // Required - Components *Components `json:"components,omitempty" yaml:"components,omitempty"` - Info *Info `json:"info" yaml:"info"` // Required - Paths *Paths `json:"paths" yaml:"paths"` // Required - Security SecurityRequirements `json:"security,omitempty" yaml:"security,omitempty"` - Servers Servers `json:"servers,omitempty" yaml:"servers,omitempty"` - Tags Tags `json:"tags,omitempty" yaml:"tags,omitempty"` - ExternalDocs *ExternalDocs `json:"externalDocs,omitempty" yaml:"externalDocs,omitempty"` + OpenAPI string `json:"openapi" yaml:"openapi"` // Required + Components *Components `json:"components,omitempty" yaml:"components,omitempty"` + Info *Info `json:"info" yaml:"info"` // Required + Paths *Paths `json:"paths" yaml:"paths"` // Required in 3.0, optional in 3.1 + Security SecurityRequirements `json:"security,omitempty" yaml:"security,omitempty"` + Servers Servers `json:"servers,omitempty" yaml:"servers,omitempty"` + Tags Tags `json:"tags,omitempty" yaml:"tags,omitempty"` + ExternalDocs *ExternalDocs `json:"externalDocs,omitempty" yaml:"externalDocs,omitempty"` + Webhooks map[string]*PathItem `json:"webhooks,omitempty" yaml:"webhooks,omitempty"` // OpenAPI >=3.1 + JSONSchemaDialect string `json:"jsonSchemaDialect,omitempty" yaml:"jsonSchemaDialect,omitempty"` // OpenAPI >=3.1 visited visitedComponent url *url.URL + + // Document-scoped format validators + // These validators are automatically used by all schemas in this document + stringFormats map[string]StringFormatValidator + numberFormats map[string]NumberFormatValidator + integerFormats map[string]IntegerFormatValidator +} + +// IsOpenAPI30 returns whether doc is an OpenAPI document version 3.0.x. +// Returns true for 3, 3.0, 3.0.0, 3.0.1, 3.0.2, 3.0.3, 3.0.4, ... +// And false for 3.1.0, 3.2, ... and for invalid strings. +func (doc *T) IsOpenAPI30() bool { + return doc.OpenAPIMajorMinor() == "3.0" +} + +// IsOpenAPI31OrLater returns whether doc is an OpenAPI document version >=3.1. +// Returns true for 3.1, 3.1.0, 3.1.1, 3.1.2, 3.2.0, ... +// And false for cases where IsOpenAPI30 returns true and for invalid strings. +func (doc *T) IsOpenAPI31OrLater() bool { + return slices.Contains([]string{"3.1", "3.2"}, doc.OpenAPIMajorMinor()) +} + +func errFieldFor31Plus(field string) error { + return fmt.Errorf("field %s is for OpenAPI >=3.1", field) +} + +func errValueOfFieldFor31Plus(value any, field string) error { + return fmt.Errorf("value %q of field %s is for OpenAPI >=3.1", value, field) +} + +// OpenAPIMajorMinor returns 3.y of the OpenAPI "3.y" or "3.y.z" version of the document. +// Returns the empty string for invalid OpenAPI version strings. +func (doc *T) OpenAPIMajorMinor() string { + if doc == nil { + return "" + } + switch doc.OpenAPI { + case "3", "3.0", "3.0.0", "3.0.1", "3.0.2", "3.0.3", "3.0.4": + return "3.0" + case "3.1", "3.1.0", "3.1.1", "3.1.2": + return "3.1" + case "3.2", "3.2.0": + return "3.2" + default: + return "" + } } var _ jsonpointer.JSONPointable = (*T)(nil) @@ -49,6 +100,10 @@ func (doc *T) JSONLookup(token string) (any, error) { return doc.Tags, nil case "externalDocs": return doc.ExternalDocs, nil + case "webhooks": + return doc.Webhooks, nil + case "jsonSchemaDialect": + return doc.JSONSchemaDialect, nil } v, _, err := jsonpointer.GetForToken(doc.Extensions, token) @@ -69,10 +124,8 @@ func (doc *T) MarshalYAML() (any, error) { if doc == nil { return nil, nil } - m := make(map[string]any, 4+len(doc.Extensions)) - for k, v := range doc.Extensions { - m[k] = v - } + m := make(map[string]any, 10+len(doc.Extensions)) + maps.Copy(m, doc.Extensions) m["openapi"] = doc.OpenAPI if x := doc.Components; x != nil { m["components"] = x @@ -91,6 +144,12 @@ func (doc *T) MarshalYAML() (any, error) { if x := doc.ExternalDocs; x != nil { m["externalDocs"] = x } + if x := doc.Webhooks; len(x) != 0 { + m["webhooks"] = x + } + if x := doc.JSONSchemaDialect; x != "" { + m["jsonSchemaDialect"] = x + } return m, nil } @@ -110,9 +169,12 @@ func (doc *T) UnmarshalJSON(data []byte) error { delete(x.Extensions, "servers") delete(x.Extensions, "tags") delete(x.Extensions, "externalDocs") + delete(x.Extensions, "webhooks") + delete(x.Extensions, "jsonSchemaDialect") if len(x.Extensions) == 0 { x.Extensions = nil } + delete(x.Webhooks, originKey) *doc = T(x) return nil } @@ -137,15 +199,86 @@ func (doc *T) AddServers(servers ...*Server) { doc.Servers = append(doc.Servers, servers...) } +// SetStringFormatValidators sets document-scoped string format validators. +// These validators are automatically used by all schemas in this document. +func (doc *T) SetStringFormatValidators(validators map[string]StringFormatValidator) { + doc.stringFormats = validators +} + +// SetStringFormatValidator sets a single document-scoped string format validator. +func (doc *T) SetStringFormatValidator(name string, validator StringFormatValidator) { + if doc.stringFormats == nil { + doc.stringFormats = make(map[string]StringFormatValidator) + } + doc.stringFormats[name] = validator +} + +// SetNumberFormatValidators sets document-scoped number format validators. +// These validators are automatically used by all schemas in this document. +func (doc *T) SetNumberFormatValidators(validators map[string]NumberFormatValidator) { + doc.numberFormats = validators +} + +// SetNumberFormatValidator sets a single document-scoped number format validator. +func (doc *T) SetNumberFormatValidator(name string, validator NumberFormatValidator) { + if doc.numberFormats == nil { + doc.numberFormats = make(map[string]NumberFormatValidator) + } + doc.numberFormats[name] = validator +} + +// SetIntegerFormatValidators sets document-scoped integer format validators. +// These validators are automatically used by all schemas in this document. +func (doc *T) SetIntegerFormatValidators(validators map[string]IntegerFormatValidator) { + doc.integerFormats = validators +} + +// SetIntegerFormatValidator sets a single document-scoped integer format validator. +func (doc *T) SetIntegerFormatValidator(name string, validator IntegerFormatValidator) { + if doc.integerFormats == nil { + doc.integerFormats = make(map[string]IntegerFormatValidator) + } + doc.integerFormats[name] = validator +} + +// GetSchemaValidationOptions returns SchemaValidationOptions that include +// this document's format validators. Use this when validating schemas from this document. +func (doc *T) GetSchemaValidationOptions() []SchemaValidationOption { + var opts []SchemaValidationOption + if doc.stringFormats != nil { + opts = append(opts, WithStringFormatValidators(doc.stringFormats)) + } + if doc.numberFormats != nil { + opts = append(opts, WithNumberFormatValidators(doc.numberFormats)) + } + if doc.integerFormats != nil { + opts = append(opts, WithIntegerFormatValidators(doc.integerFormats)) + } + return opts +} + // Validate returns an error if T does not comply with the OpenAPI spec. // Validations Options can be provided to modify the validation behavior. +// +// By default, doc.OpenAPI's field dictates whether "JSON Schema Draft 2020-12" validation +// is enabled. func (doc *T) Validate(ctx context.Context, opts ...ValidationOption) error { + if doc.IsOpenAPI31OrLater() { + opts = append(opts, IsOpenAPI31OrLater()) + } ctx = WithValidationOptions(ctx, opts...) if doc.OpenAPI == "" { return errors.New("value of openapi must be a non-empty string") } + if doc.Webhooks != nil && !doc.IsOpenAPI31OrLater() { + return errFieldFor31Plus("webhooks") + } + if doc.JSONSchemaDialect != "" && !doc.IsOpenAPI31OrLater() { + return errFieldFor31Plus("jsonschemadialect") + } + var wrap func(error) error wrap = func(e error) error { return fmt.Errorf("invalid components: %w", e) } @@ -169,7 +302,7 @@ func (doc *T) Validate(ctx context.Context, opts ...ValidationOption) error { if err := v.Validate(ctx); err != nil { return wrap(err) } - } else { + } else if doc.IsOpenAPI30() { return wrap(errors.New("must be an object")) } @@ -201,5 +334,35 @@ func (doc *T) Validate(ctx context.Context, opts ...ValidationOption) error { } } + wrap = func(e error) error { return fmt.Errorf("invalid webhooks: %w", e) } + for _, name := range componentNames(doc.Webhooks) { + pathItem := doc.Webhooks[name] + if pathItem == nil { + return wrap(fmt.Errorf("webhook %q is nil", name)) + } + if err := pathItem.Validate(ctx); err != nil { + return wrap(fmt.Errorf("webhook %q: %w", name, err)) + } + } + + wrap = func(e error) error { return fmt.Errorf("invalid jsonSchemaDialect: %w", e) } + if doc.JSONSchemaDialect != "" { + u, err := url.Parse(doc.JSONSchemaDialect) + if err != nil { + return wrap(err) + } + if u.Scheme == "" { + return wrap(errors.New("must be an absolute URI with a scheme")) + } + } + return validateExtensions(ctx, doc.Extensions) } + +// ValidateSchemaJSON validates data against a schema using this document's format validators. +// This is a convenience method that automatically applies the document's format validators. +func (doc *T) ValidateSchemaJSON(schema *Schema, value any, opts ...SchemaValidationOption) error { + // Combine document's validators with any additional options + allOpts := append(doc.GetSchemaValidationOptions(), opts...) + return schema.VisitJSON(value, allOpts...) +} diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/operation.go b/vendor/github.com/getkin/kin-openapi/openapi3/operation.go index f32836e..f1d0132 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/operation.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/operation.go @@ -5,6 +5,7 @@ import ( "encoding/json" "errors" "fmt" + "maps" "strconv" "github.com/go-openapi/jsonpointer" @@ -14,7 +15,7 @@ import ( // See https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.0.3.md#operation-object type Operation struct { Extensions map[string]any `json:"-" yaml:"-"` - Origin *Origin `json:"__origin__,omitempty" yaml:"__origin__,omitempty"` + Origin *Origin `json:"-" yaml:"-"` // Optional tags for documentation. Tags []string `json:"tags,omitempty" yaml:"tags,omitempty"` @@ -69,9 +70,7 @@ func (operation Operation) MarshalJSON() ([]byte, error) { // MarshalYAML returns the YAML encoding of Operation. func (operation Operation) MarshalYAML() (any, error) { m := make(map[string]any, 12+len(operation.Extensions)) - for k, v := range operation.Extensions { - m[k] = v - } + maps.Copy(m, operation.Extensions) if x := operation.Tags; len(x) != 0 { m["tags"] = x } @@ -117,7 +116,6 @@ func (operation *Operation) UnmarshalJSON(data []byte) error { return unmarshalError(err) } _ = json.Unmarshal(data, &x.Extensions) - delete(x.Extensions, originKey) delete(x.Extensions, "tags") delete(x.Extensions, "summary") delete(x.Extensions, "description") diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/origin.go b/vendor/github.com/getkin/kin-openapi/openapi3/origin.go index d2a51d9..1403bd8 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/origin.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/origin.go @@ -1,17 +1,255 @@ package openapi3 +import ( + "reflect" + "strings" + + "github.com/oasdiff/yaml" +) + const originKey = "__origin__" +var originPtrType = reflect.TypeFor[*Origin]() + // Origin contains the origin of a collection. // Key is the location of the collection itself. -// Fields is a map of the location of each field in the collection. +// Fields is a map of the location of each scalar field in the collection. +// Sequences is a map of the location of each item in sequence-valued fields. type Origin struct { - Key *Location `json:"key,omitempty" yaml:"key,omitempty"` - Fields map[string]Location `json:"fields,omitempty" yaml:"fields,omitempty"` + Key *Location `json:"key,omitempty" yaml:"key,omitempty"` + Fields map[string]Location `json:"fields,omitempty" yaml:"fields,omitempty"` + Sequences map[string][]Location `json:"sequences,omitempty" yaml:"sequences,omitempty"` } // Location is a struct that contains the location of a field. type Location struct { - Line int `json:"line,omitempty" yaml:"line,omitempty"` - Column int `json:"column,omitempty" yaml:"column,omitempty"` + File string `json:"file,omitempty" yaml:"file,omitempty"` + Line int `json:"line,omitempty" yaml:"line,omitempty"` + Column int `json:"column,omitempty" yaml:"column,omitempty"` + Name string `json:"name,omitempty" yaml:"name,omitempty"` +} + +// originFromSeq parses the compact []any sequence produced by yaml3's addOrigin. +// +// Format: [file, key_name, key_line, key_col, nf, f1_name, f1_delta, f1_col, ..., ns, s1_name, s1_count, s1_l0_delta, s1_c0, ...] +func originFromSeq(s []any) *Origin { + // Need at least: file, key_name, key_line, key_col, nf, ns + if len(s) < 6 { + return nil + } + file, _ := s[0].(string) + keyName, _ := s[1].(string) + keyLine := toInt(s[2]) + keyCol := toInt(s[3]) + + o := &Origin{ + Key: &Location{ + File: file, + Line: keyLine, + Column: keyCol, + Name: keyName, + }, + } + + idx := 4 + nf := toInt(s[idx]) + idx++ + if nf > 0 && idx+nf*3 <= len(s) { + o.Fields = make(map[string]Location, nf) + for range nf { + fname, _ := s[idx].(string) + delta := toInt(s[idx+1]) + col := toInt(s[idx+2]) + o.Fields[fname] = Location{ + File: file, + Line: keyLine + delta, + Column: col, + Name: fname, + } + idx += 3 + } + } + + if idx >= len(s) { + return o + } + ns := toInt(s[idx]) + idx++ + if ns > 0 { + o.Sequences = make(map[string][]Location, ns) + for range ns { + if idx >= len(s) { + break + } + sname, _ := s[idx].(string) + idx++ + if idx >= len(s) { + break + } + count := toInt(s[idx]) + idx++ + locs := make([]Location, count) + for j := 0; j < count && idx+2 < len(s); j++ { + name, _ := s[idx].(string) + delta := toInt(s[idx+1]) + col := toInt(s[idx+2]) + locs[j] = Location{File: file, Line: keyLine + delta, Column: col, Name: name} + idx += 3 + } + o.Sequences[sname] = locs + } + } + return o +} + +// toInt converts numeric types to int. Handles int/uint64 from YAML decoding. +func toInt(v any) int { + switch n := v.(type) { + case int: + return n + case uint64: + return int(n) + } + return 0 +} + +// applyOrigins walks a Go struct tree and a parallel OriginTree, setting +// Origin fields on each struct from the extracted origin data. +func applyOrigins(v any, tree *yaml.OriginTree) { + if tree == nil { + return + } + applyOriginsToValue(reflect.ValueOf(v), tree) +} + +func applyOriginsToValue(val reflect.Value, tree *yaml.OriginTree) { + // Keep track of the last pointer so we can pass it to struct handlers + // (needed for calling methods like Map() on maplike types). + var ptr reflect.Value + for val.Kind() == reflect.Pointer || val.Kind() == reflect.Interface { + if val.IsNil() { + return + } + if val.Kind() == reflect.Pointer { + ptr = val + } + val = val.Elem() + } + + switch val.Kind() { + case reflect.Struct: + applyOriginsToStruct(val, ptr, tree) + case reflect.Map: + applyOriginsToMap(val, tree) + case reflect.Slice: + applyOriginsToSlice(val, tree) + } +} + +func applyOriginsToStruct(val reflect.Value, ptr reflect.Value, tree *yaml.OriginTree) { + typ := val.Type() + + // Set Origin field for structs whose Origin field has a "-" json tag. + if tree.Origin != nil { + if sf, ok := typ.FieldByName("Origin"); ok && sf.Type == originPtrType { + tag := sf.Tag.Get("json") + if tag == "-" { + if s, ok := tree.Origin.([]any); ok { + val.FieldByName("Origin").Set(reflect.ValueOf(originFromSeq(s))) + } + } + } + } + + // Recurse into exported struct fields using json tags + for i := range typ.NumField() { + sf := typ.Field(i) + if !sf.IsExported() { + continue + } + tag := jsonTagName(sf) + if tag == "" || tag == "-" { + continue + } + childTree := tree.Fields[tag] + if childTree != nil { + applyOriginsToValue(val.Field(i), childTree) + } + } + + // Handle wrapper types whose inner struct has no json tag: + // - *Ref types (e.g. SchemaRef, ResponseRef) have a "Value" field + // - BoolSchema (AdditionalProperties, UnevaluatedProperties, UnevaluatedItems) has a "Schema" field + // The origin tree data applies to the inner struct, not a sub-key. + for _, fieldName := range []string{"Value", "Schema"} { + vf := val.FieldByName(fieldName) + if !vf.IsValid() || vf.Kind() != reflect.Pointer || vf.IsNil() { + continue + } + sf, _ := typ.FieldByName(fieldName) + if sf.Tag.Get("json") == "" { + applyOriginsToValue(vf, tree) + } + } + + // Handle "maplike" types (Paths, Responses, Callback) whose items are + // stored in an unexported map accessible via a Map() method. + // Use the original pointer (if available) since dereferenced values + // are not addressable. + receiver := val + if ptr.IsValid() { + receiver = ptr + } else if val.CanAddr() { + receiver = val.Addr() + } + if receiver.Kind() == reflect.Pointer { + if mapMethod := receiver.MethodByName("Map"); mapMethod.IsValid() { + results := mapMethod.Call(nil) + if len(results) == 1 { + applyOriginsToMap(results[0], tree) + } + } + } +} + +func applyOriginsToMap(val reflect.Value, tree *yaml.OriginTree) { + if tree.Fields == nil { + return + } + for _, key := range val.MapKeys() { + childTree := tree.Fields[key.String()] + if childTree == nil { + continue + } + elem := val.MapIndex(key) + // Map values are not addressable. For pointer-typed values we can + // recurse directly. For value types we must copy, apply, and set back. + if elem.Kind() == reflect.Pointer || elem.Kind() == reflect.Interface { + applyOriginsToValue(elem, childTree) + } else if elem.Kind() == reflect.Struct { + // Copy to a settable value + cp := reflect.New(elem.Type()).Elem() + cp.Set(elem) + applyOriginsToStruct(cp, reflect.Value{}, childTree) + val.SetMapIndex(key, cp) + } + } +} + +func applyOriginsToSlice(val reflect.Value, tree *yaml.OriginTree) { + for i := 0; i < val.Len() && i < len(tree.Items); i++ { + if tree.Items[i] != nil { + applyOriginsToValue(val.Index(i), tree.Items[i]) + } + } +} + +// jsonTagName returns the JSON field name from a struct field's json tag. +func jsonTagName(f reflect.StructField) string { + tag := f.Tag.Get("json") + if tag == "" { + return "" + } + name, _, _ := strings.Cut(tag, ",") + return name } diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/parameter.go b/vendor/github.com/getkin/kin-openapi/openapi3/parameter.go index 23582f7..b85a2df 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/parameter.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/parameter.go @@ -5,7 +5,7 @@ import ( "encoding/json" "errors" "fmt" - "sort" + "maps" "strconv" "github.com/go-openapi/jsonpointer" @@ -73,7 +73,7 @@ func (parameters Parameters) Validate(ctx context.Context, opts ...ValidationOpt // See https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.0.3.md#parameter-object type Parameter struct { Extensions map[string]any `json:"-" yaml:"-"` - Origin *Origin `json:"__origin__,omitempty" yaml:"__origin__,omitempty"` + Origin *Origin `json:"-" yaml:"-"` Name string `json:"name,omitempty" yaml:"name,omitempty"` In string `json:"in,omitempty" yaml:"in,omitempty"` @@ -161,9 +161,7 @@ func (parameter Parameter) MarshalJSON() ([]byte, error) { // MarshalYAML returns the YAML encoding of Parameter. func (parameter Parameter) MarshalYAML() (any, error) { m := make(map[string]any, 13+len(parameter.Extensions)) - for k, v := range parameter.Extensions { - m[k] = v - } + maps.Copy(m, parameter.Extensions) if x := parameter.Name; x != "" { m["name"] = x @@ -217,7 +215,6 @@ func (parameter *Parameter) UnmarshalJSON(data []byte) error { } _ = json.Unmarshal(data, &x.Extensions) - delete(x.Extensions, originKey) delete(x.Extensions, "name") delete(x.Extensions, "in") delete(x.Extensions, "description") @@ -397,12 +394,7 @@ func (parameter *Parameter) Validate(ctx context.Context, opts ...ValidationOpti return fmt.Errorf("invalid example: %w", err) } } else if examples := parameter.Examples; examples != nil { - names := make([]string, 0, len(examples)) - for name := range examples { - names = append(names, name) - } - sort.Strings(names) - for _, k := range names { + for _, k := range componentNames(examples) { v := examples[k] if err := v.Validate(ctx); err != nil { return fmt.Errorf("%s: %w", k, err) @@ -419,6 +411,6 @@ func (parameter *Parameter) Validate(ctx context.Context, opts ...ValidationOpti // UnmarshalJSON sets ParametersMap to a copy of data. func (parametersMap *ParametersMap) UnmarshalJSON(data []byte) (err error) { - *parametersMap, _, err = unmarshalStringMapP[ParameterRef](data) + *parametersMap, err = unmarshalStringMapP[ParameterRef](data) return } diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/path_item.go b/vendor/github.com/getkin/kin-openapi/openapi3/path_item.go index 9839786..4b17c51 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/path_item.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/path_item.go @@ -4,15 +4,15 @@ import ( "context" "encoding/json" "fmt" + "maps" "net/http" - "sort" ) // PathItem is specified by OpenAPI/Swagger standard version 3. // See https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.0.3.md#path-item-object type PathItem struct { Extensions map[string]any `json:"-" yaml:"-"` - Origin *Origin `json:"__origin__,omitempty" yaml:"__origin__,omitempty"` + Origin *Origin `json:"-" yaml:"-"` Ref string `json:"$ref,omitempty" yaml:"$ref,omitempty"` Summary string `json:"summary,omitempty" yaml:"summary,omitempty"` @@ -46,9 +46,7 @@ func (pathItem PathItem) MarshalYAML() (any, error) { } m := make(map[string]any, 13+len(pathItem.Extensions)) - for k, v := range pathItem.Extensions { - m[k] = v - } + maps.Copy(m, pathItem.Extensions) if x := pathItem.Summary; x != "" { m["summary"] = x } @@ -99,7 +97,6 @@ func (pathItem *PathItem) UnmarshalJSON(data []byte) error { return unmarshalError(err) } _ = json.Unmarshal(data, &x.Extensions) - delete(x.Extensions, originKey) delete(x.Extensions, "$ref") delete(x.Extensions, "summary") delete(x.Extensions, "description") @@ -209,12 +206,7 @@ func (pathItem *PathItem) Validate(ctx context.Context, opts ...ValidationOption operations := pathItem.Operations() - methods := make([]string, 0, len(operations)) - for method := range operations { - methods = append(methods, method) - } - sort.Strings(methods) - for _, method := range methods { + for _, method := range componentNames(operations) { operation := operations[method] if err := operation.Validate(ctx); err != nil { return fmt.Errorf("invalid operation %s: %v", method, err) diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/paths.go b/vendor/github.com/getkin/kin-openapi/openapi3/paths.go index edd8c87..8082e37 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/paths.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/paths.go @@ -1,9 +1,10 @@ package openapi3 import ( + "cmp" "context" "fmt" - "sort" + "slices" "strings" ) @@ -11,7 +12,7 @@ import ( // See https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.0.3.md#paths-object type Paths struct { Extensions map[string]any `json:"-" yaml:"-"` - Origin *Origin `json:"__origin__,omitempty" yaml:"__origin__,omitempty"` + Origin *Origin `json:"-" yaml:"-"` m map[string]*PathItem } @@ -43,12 +44,7 @@ func (paths *Paths) Validate(ctx context.Context, opts ...ValidationOption) erro normalizedPaths := make(map[string]string, paths.Len()) - keys := make([]string, 0, paths.Len()) - for key := range paths.Map() { - keys = append(keys, key) - } - sort.Strings(keys) - for _, path := range keys { + for _, path := range paths.Keys() { pathItem := paths.Value(path) if path == "" || path[0] != '/' { return fmt.Errorf("path %q does not start with a forward slash (/)", path) @@ -74,12 +70,7 @@ func (paths *Paths) Validate(ctx context.Context, opts ...ValidationOption) erro } } operations := pathItem.Operations() - methods := make([]string, 0, len(operations)) - for method := range operations { - methods = append(methods, method) - } - sort.Strings(methods) - for _, method := range methods { + for _, method := range componentNames(operations) { operation := operations[method] var setParams []string for _, parameterRef := range operation.Parameters { @@ -101,23 +92,14 @@ func (paths *Paths) Validate(ctx context.Context, opts ...ValidationOption) erro missing[name] = struct{}{} } } - for name := range varsInPath { - got := false - for _, othername := range definedParams { - if othername == name { - got = true - break - } - } - if !got { - missing[name] = struct{}{} + for _, name := range componentNames(varsInPath) { + if slices.Contains(definedParams, name) { + break } + missing[name] = struct{}{} } if len(missing) != 0 { - missings := make([]string, 0, len(missing)) - for name := range missing { - missings = append(missings, name) - } + missings := componentNames(missing) return fmt.Errorf("operation %s %s must define exactly all path parameters (missing: %v)", method, path, missings) } } @@ -159,7 +141,7 @@ func (paths *Paths) InMatchingOrder() []string { ordered := make([]string, 0, paths.Len()) for c := 0; c <= max; c++ { if ps, ok := vars[c]; ok { - sort.Sort(sort.Reverse(sort.StringSlice(ps))) + slices.SortFunc(ps, func(a, b string) int { return cmp.Compare(b, a) }) ordered = append(ordered, ps...) } } @@ -186,10 +168,11 @@ func (paths *Paths) Find(key string) *PathItem { } normalizedPath, expected, _ := normalizeTemplatedPath(key) - for path, pathItem := range paths.Map() { + pathsMap := paths.Map() + for _, path := range componentNames(pathsMap) { pathNormalized, got, _ := normalizeTemplatedPath(path) if got == expected && pathNormalized == normalizedPath { - return pathItem + return pathsMap[path] } } return nil @@ -197,11 +180,15 @@ func (paths *Paths) Find(key string) *PathItem { func (paths *Paths) validateUniqueOperationIDs() error { operationIDs := make(map[string]string) - for urlPath, pathItem := range paths.Map() { + pathsMap := paths.Map() + for _, urlPath := range componentNames(pathsMap) { + pathItem := pathsMap[urlPath] if pathItem == nil { continue } - for httpMethod, operation := range pathItem.Operations() { + operations := pathItem.Operations() + for _, httpMethod := range componentNames(operations) { + operation := operations[httpMethod] if operation == nil || operation.OperationID == "" { continue } diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/ref.go b/vendor/github.com/getkin/kin-openapi/openapi3/ref.go index 83893b6..5352806 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/ref.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/ref.go @@ -1,10 +1,42 @@ package openapi3 +import ( + "context" + "encoding/json" + "maps" +) + //go:generate go run refsgenerator.go // Ref is specified by OpenAPI/Swagger 3.0 standard. // See https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.0.3.md#reference-object type Ref struct { - Ref string `json:"$ref" yaml:"$ref"` - Origin *Origin `json:"__origin__,omitempty" yaml:"__origin__,omitempty"` + Ref string `json:"$ref" yaml:"$ref"` + Extensions map[string]any `json:"-" yaml:"-"` + Origin *Origin `json:"-" yaml:"-"` +} + +// MarshalYAML returns the YAML encoding of Ref. +func (x Ref) MarshalYAML() (any, error) { + m := make(map[string]any, 1+len(x.Extensions)) + maps.Copy(m, x.Extensions) + if x := x.Ref; x != "" { + m["$ref"] = x + } + return m, nil +} + +// MarshalJSON returns the JSON encoding of Ref. +func (x Ref) MarshalJSON() ([]byte, error) { + y, err := x.MarshalYAML() + if err != nil { + return nil, err + } + return json.Marshal(y) +} + +// Validate returns an error if Extensions does not comply with the OpenAPI spec. +func (e *Ref) Validate(ctx context.Context, opts ...ValidationOption) error { + ctx = WithValidationOptions(ctx, opts...) + return validateExtensions(ctx, e.Extensions) } diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/refs.go b/vendor/github.com/getkin/kin-openapi/openapi3/refs.go index fc11164..87cc860 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/refs.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/refs.go @@ -1,4 +1,4 @@ -// Code generated by go generate; DO NOT EDIT. +// Code generated by go generate using refs.tmpl; DO NOT EDIT refs.go. package openapi3 import ( @@ -6,7 +6,6 @@ import ( "encoding/json" "fmt" "net/url" - "sort" "strings" "github.com/go-openapi/jsonpointer" @@ -19,7 +18,7 @@ type CallbackRef struct { // Extensions only captures fields starting with 'x-' as no other fields // are allowed by the openapi spec. Extensions map[string]any - Origin *Origin + Origin *Origin `json:"-" yaml:"-"` Ref string Value *Callback @@ -54,7 +53,7 @@ func (x *CallbackRef) setRefPath(u *url.URL) { // MarshalYAML returns the YAML encoding of CallbackRef. func (x CallbackRef) MarshalYAML() (any, error) { if ref := x.Ref; ref != "" { - return &Ref{Ref: ref}, nil + return &Ref{Ref: ref, Extensions: x.Extensions}, nil } return x.Value.MarshalYAML() } @@ -75,11 +74,7 @@ func (x *CallbackRef) UnmarshalJSON(data []byte) error { x.Ref = refOnly.Ref x.Origin = refOnly.Origin if len(extra) != 0 { - x.extra = make([]string, 0, len(extra)) - for key := range extra { - x.extra = append(x.extra, key) - } - sort.Strings(x.extra) + x.extra = componentNames(extra) for k := range extra { if !strings.HasPrefix(k, "x-") { delete(extra, k) @@ -94,41 +89,46 @@ func (x *CallbackRef) UnmarshalJSON(data []byte) error { return json.Unmarshal(data, &x.Value) } -// Validate returns an error if CallbackRef does not comply with the OpenAPI spec. -func (x *CallbackRef) Validate(ctx context.Context, opts ...ValidationOption) error { - ctx = WithValidationOptions(ctx, opts...) - exProhibited := getValidationOptions(ctx).schemaExtensionsInRefProhibited +// validateExtras returns an error if CallbackRef has sibling fields +// alongside $ref that are not allowed by the validation options. +func (x *CallbackRef) validateExtras(ctx context.Context) error { + validationOpts := getValidationOptions(ctx) var extras []string - if extra := x.extra; len(extra) != 0 { - allowed := getValidationOptions(ctx).extraSiblingFieldsAllowed - for _, ex := range extra { - if allowed != nil { - if _, ok := allowed[ex]; ok { - continue - } - } - // extras in the Extensions checked below + + allowed := validationOpts.extraSiblingFieldsAllowed + if allowed == nil { + allowed = make(map[string]struct{}) + } + for _, ex := range x.extra { + if _, ok := allowed[ex]; !ok { if _, ok := x.Extensions[ex]; !ok { extras = append(extras, ex) } + // extras in the Extensions checked below } } - if extra := x.Extensions; exProhibited && len(extra) != 0 { - allowed := getValidationOptions(ctx).extraSiblingFieldsAllowed - for ex := range extra { - if allowed != nil { - if _, ok := allowed[ex]; ok { - continue - } + if validationOpts.schemaExtensionsInRefProhibited { + for _, ex := range componentNames(x.Extensions) { + if _, ok := allowed[ex]; !ok { + extras = append(extras, ex) } - extras = append(extras, ex) + // extras in the Extensions checked below } } if len(extras) != 0 { return fmt.Errorf("extra sibling fields: %+v", extras) } + return nil +} + +// Validate returns an error if CallbackRef does not comply with the OpenAPI spec. +func (x *CallbackRef) Validate(ctx context.Context, opts ...ValidationOption) error { + ctx = WithValidationOptions(ctx, opts...) + if err := x.validateExtras(ctx); err != nil { + return err + } if v := x.Value; v != nil { return v.Validate(ctx) @@ -157,7 +157,7 @@ type ExampleRef struct { // Extensions only captures fields starting with 'x-' as no other fields // are allowed by the openapi spec. Extensions map[string]any - Origin *Origin + Origin *Origin `json:"-" yaml:"-"` Ref string Value *Example @@ -192,7 +192,7 @@ func (x *ExampleRef) setRefPath(u *url.URL) { // MarshalYAML returns the YAML encoding of ExampleRef. func (x ExampleRef) MarshalYAML() (any, error) { if ref := x.Ref; ref != "" { - return &Ref{Ref: ref}, nil + return &Ref{Ref: ref, Extensions: x.Extensions}, nil } return x.Value.MarshalYAML() } @@ -213,11 +213,7 @@ func (x *ExampleRef) UnmarshalJSON(data []byte) error { x.Ref = refOnly.Ref x.Origin = refOnly.Origin if len(extra) != 0 { - x.extra = make([]string, 0, len(extra)) - for key := range extra { - x.extra = append(x.extra, key) - } - sort.Strings(x.extra) + x.extra = componentNames(extra) for k := range extra { if !strings.HasPrefix(k, "x-") { delete(extra, k) @@ -232,41 +228,46 @@ func (x *ExampleRef) UnmarshalJSON(data []byte) error { return json.Unmarshal(data, &x.Value) } -// Validate returns an error if ExampleRef does not comply with the OpenAPI spec. -func (x *ExampleRef) Validate(ctx context.Context, opts ...ValidationOption) error { - ctx = WithValidationOptions(ctx, opts...) - exProhibited := getValidationOptions(ctx).schemaExtensionsInRefProhibited +// validateExtras returns an error if ExampleRef has sibling fields +// alongside $ref that are not allowed by the validation options. +func (x *ExampleRef) validateExtras(ctx context.Context) error { + validationOpts := getValidationOptions(ctx) var extras []string - if extra := x.extra; len(extra) != 0 { - allowed := getValidationOptions(ctx).extraSiblingFieldsAllowed - for _, ex := range extra { - if allowed != nil { - if _, ok := allowed[ex]; ok { - continue - } - } - // extras in the Extensions checked below + + allowed := validationOpts.extraSiblingFieldsAllowed + if allowed == nil { + allowed = make(map[string]struct{}) + } + for _, ex := range x.extra { + if _, ok := allowed[ex]; !ok { if _, ok := x.Extensions[ex]; !ok { extras = append(extras, ex) } + // extras in the Extensions checked below } } - if extra := x.Extensions; exProhibited && len(extra) != 0 { - allowed := getValidationOptions(ctx).extraSiblingFieldsAllowed - for ex := range extra { - if allowed != nil { - if _, ok := allowed[ex]; ok { - continue - } + if validationOpts.schemaExtensionsInRefProhibited { + for _, ex := range componentNames(x.Extensions) { + if _, ok := allowed[ex]; !ok { + extras = append(extras, ex) } - extras = append(extras, ex) + // extras in the Extensions checked below } } if len(extras) != 0 { return fmt.Errorf("extra sibling fields: %+v", extras) } + return nil +} + +// Validate returns an error if ExampleRef does not comply with the OpenAPI spec. +func (x *ExampleRef) Validate(ctx context.Context, opts ...ValidationOption) error { + ctx = WithValidationOptions(ctx, opts...) + if err := x.validateExtras(ctx); err != nil { + return err + } if v := x.Value; v != nil { return v.Validate(ctx) @@ -295,7 +296,7 @@ type HeaderRef struct { // Extensions only captures fields starting with 'x-' as no other fields // are allowed by the openapi spec. Extensions map[string]any - Origin *Origin + Origin *Origin `json:"-" yaml:"-"` Ref string Value *Header @@ -330,7 +331,7 @@ func (x *HeaderRef) setRefPath(u *url.URL) { // MarshalYAML returns the YAML encoding of HeaderRef. func (x HeaderRef) MarshalYAML() (any, error) { if ref := x.Ref; ref != "" { - return &Ref{Ref: ref}, nil + return &Ref{Ref: ref, Extensions: x.Extensions}, nil } return x.Value.MarshalYAML() } @@ -351,11 +352,7 @@ func (x *HeaderRef) UnmarshalJSON(data []byte) error { x.Ref = refOnly.Ref x.Origin = refOnly.Origin if len(extra) != 0 { - x.extra = make([]string, 0, len(extra)) - for key := range extra { - x.extra = append(x.extra, key) - } - sort.Strings(x.extra) + x.extra = componentNames(extra) for k := range extra { if !strings.HasPrefix(k, "x-") { delete(extra, k) @@ -370,41 +367,46 @@ func (x *HeaderRef) UnmarshalJSON(data []byte) error { return json.Unmarshal(data, &x.Value) } -// Validate returns an error if HeaderRef does not comply with the OpenAPI spec. -func (x *HeaderRef) Validate(ctx context.Context, opts ...ValidationOption) error { - ctx = WithValidationOptions(ctx, opts...) - exProhibited := getValidationOptions(ctx).schemaExtensionsInRefProhibited +// validateExtras returns an error if HeaderRef has sibling fields +// alongside $ref that are not allowed by the validation options. +func (x *HeaderRef) validateExtras(ctx context.Context) error { + validationOpts := getValidationOptions(ctx) var extras []string - if extra := x.extra; len(extra) != 0 { - allowed := getValidationOptions(ctx).extraSiblingFieldsAllowed - for _, ex := range extra { - if allowed != nil { - if _, ok := allowed[ex]; ok { - continue - } - } - // extras in the Extensions checked below + + allowed := validationOpts.extraSiblingFieldsAllowed + if allowed == nil { + allowed = make(map[string]struct{}) + } + for _, ex := range x.extra { + if _, ok := allowed[ex]; !ok { if _, ok := x.Extensions[ex]; !ok { extras = append(extras, ex) } + // extras in the Extensions checked below } } - if extra := x.Extensions; exProhibited && len(extra) != 0 { - allowed := getValidationOptions(ctx).extraSiblingFieldsAllowed - for ex := range extra { - if allowed != nil { - if _, ok := allowed[ex]; ok { - continue - } + if validationOpts.schemaExtensionsInRefProhibited { + for _, ex := range componentNames(x.Extensions) { + if _, ok := allowed[ex]; !ok { + extras = append(extras, ex) } - extras = append(extras, ex) + // extras in the Extensions checked below } } if len(extras) != 0 { return fmt.Errorf("extra sibling fields: %+v", extras) } + return nil +} + +// Validate returns an error if HeaderRef does not comply with the OpenAPI spec. +func (x *HeaderRef) Validate(ctx context.Context, opts ...ValidationOption) error { + ctx = WithValidationOptions(ctx, opts...) + if err := x.validateExtras(ctx); err != nil { + return err + } if v := x.Value; v != nil { return v.Validate(ctx) @@ -433,7 +435,7 @@ type LinkRef struct { // Extensions only captures fields starting with 'x-' as no other fields // are allowed by the openapi spec. Extensions map[string]any - Origin *Origin + Origin *Origin `json:"-" yaml:"-"` Ref string Value *Link @@ -468,7 +470,7 @@ func (x *LinkRef) setRefPath(u *url.URL) { // MarshalYAML returns the YAML encoding of LinkRef. func (x LinkRef) MarshalYAML() (any, error) { if ref := x.Ref; ref != "" { - return &Ref{Ref: ref}, nil + return &Ref{Ref: ref, Extensions: x.Extensions}, nil } return x.Value.MarshalYAML() } @@ -489,11 +491,7 @@ func (x *LinkRef) UnmarshalJSON(data []byte) error { x.Ref = refOnly.Ref x.Origin = refOnly.Origin if len(extra) != 0 { - x.extra = make([]string, 0, len(extra)) - for key := range extra { - x.extra = append(x.extra, key) - } - sort.Strings(x.extra) + x.extra = componentNames(extra) for k := range extra { if !strings.HasPrefix(k, "x-") { delete(extra, k) @@ -508,41 +506,46 @@ func (x *LinkRef) UnmarshalJSON(data []byte) error { return json.Unmarshal(data, &x.Value) } -// Validate returns an error if LinkRef does not comply with the OpenAPI spec. -func (x *LinkRef) Validate(ctx context.Context, opts ...ValidationOption) error { - ctx = WithValidationOptions(ctx, opts...) - exProhibited := getValidationOptions(ctx).schemaExtensionsInRefProhibited +// validateExtras returns an error if LinkRef has sibling fields +// alongside $ref that are not allowed by the validation options. +func (x *LinkRef) validateExtras(ctx context.Context) error { + validationOpts := getValidationOptions(ctx) var extras []string - if extra := x.extra; len(extra) != 0 { - allowed := getValidationOptions(ctx).extraSiblingFieldsAllowed - for _, ex := range extra { - if allowed != nil { - if _, ok := allowed[ex]; ok { - continue - } - } - // extras in the Extensions checked below + + allowed := validationOpts.extraSiblingFieldsAllowed + if allowed == nil { + allowed = make(map[string]struct{}) + } + for _, ex := range x.extra { + if _, ok := allowed[ex]; !ok { if _, ok := x.Extensions[ex]; !ok { extras = append(extras, ex) } + // extras in the Extensions checked below } } - if extra := x.Extensions; exProhibited && len(extra) != 0 { - allowed := getValidationOptions(ctx).extraSiblingFieldsAllowed - for ex := range extra { - if allowed != nil { - if _, ok := allowed[ex]; ok { - continue - } + if validationOpts.schemaExtensionsInRefProhibited { + for _, ex := range componentNames(x.Extensions) { + if _, ok := allowed[ex]; !ok { + extras = append(extras, ex) } - extras = append(extras, ex) + // extras in the Extensions checked below } } if len(extras) != 0 { return fmt.Errorf("extra sibling fields: %+v", extras) } + return nil +} + +// Validate returns an error if LinkRef does not comply with the OpenAPI spec. +func (x *LinkRef) Validate(ctx context.Context, opts ...ValidationOption) error { + ctx = WithValidationOptions(ctx, opts...) + if err := x.validateExtras(ctx); err != nil { + return err + } if v := x.Value; v != nil { return v.Validate(ctx) @@ -571,7 +574,7 @@ type ParameterRef struct { // Extensions only captures fields starting with 'x-' as no other fields // are allowed by the openapi spec. Extensions map[string]any - Origin *Origin + Origin *Origin `json:"-" yaml:"-"` Ref string Value *Parameter @@ -606,7 +609,7 @@ func (x *ParameterRef) setRefPath(u *url.URL) { // MarshalYAML returns the YAML encoding of ParameterRef. func (x ParameterRef) MarshalYAML() (any, error) { if ref := x.Ref; ref != "" { - return &Ref{Ref: ref}, nil + return &Ref{Ref: ref, Extensions: x.Extensions}, nil } return x.Value.MarshalYAML() } @@ -627,11 +630,7 @@ func (x *ParameterRef) UnmarshalJSON(data []byte) error { x.Ref = refOnly.Ref x.Origin = refOnly.Origin if len(extra) != 0 { - x.extra = make([]string, 0, len(extra)) - for key := range extra { - x.extra = append(x.extra, key) - } - sort.Strings(x.extra) + x.extra = componentNames(extra) for k := range extra { if !strings.HasPrefix(k, "x-") { delete(extra, k) @@ -646,41 +645,46 @@ func (x *ParameterRef) UnmarshalJSON(data []byte) error { return json.Unmarshal(data, &x.Value) } -// Validate returns an error if ParameterRef does not comply with the OpenAPI spec. -func (x *ParameterRef) Validate(ctx context.Context, opts ...ValidationOption) error { - ctx = WithValidationOptions(ctx, opts...) - exProhibited := getValidationOptions(ctx).schemaExtensionsInRefProhibited +// validateExtras returns an error if ParameterRef has sibling fields +// alongside $ref that are not allowed by the validation options. +func (x *ParameterRef) validateExtras(ctx context.Context) error { + validationOpts := getValidationOptions(ctx) var extras []string - if extra := x.extra; len(extra) != 0 { - allowed := getValidationOptions(ctx).extraSiblingFieldsAllowed - for _, ex := range extra { - if allowed != nil { - if _, ok := allowed[ex]; ok { - continue - } - } - // extras in the Extensions checked below + + allowed := validationOpts.extraSiblingFieldsAllowed + if allowed == nil { + allowed = make(map[string]struct{}) + } + for _, ex := range x.extra { + if _, ok := allowed[ex]; !ok { if _, ok := x.Extensions[ex]; !ok { extras = append(extras, ex) } + // extras in the Extensions checked below } } - if extra := x.Extensions; exProhibited && len(extra) != 0 { - allowed := getValidationOptions(ctx).extraSiblingFieldsAllowed - for ex := range extra { - if allowed != nil { - if _, ok := allowed[ex]; ok { - continue - } + if validationOpts.schemaExtensionsInRefProhibited { + for _, ex := range componentNames(x.Extensions) { + if _, ok := allowed[ex]; !ok { + extras = append(extras, ex) } - extras = append(extras, ex) + // extras in the Extensions checked below } } if len(extras) != 0 { return fmt.Errorf("extra sibling fields: %+v", extras) } + return nil +} + +// Validate returns an error if ParameterRef does not comply with the OpenAPI spec. +func (x *ParameterRef) Validate(ctx context.Context, opts ...ValidationOption) error { + ctx = WithValidationOptions(ctx, opts...) + if err := x.validateExtras(ctx); err != nil { + return err + } if v := x.Value; v != nil { return v.Validate(ctx) @@ -709,7 +713,7 @@ type RequestBodyRef struct { // Extensions only captures fields starting with 'x-' as no other fields // are allowed by the openapi spec. Extensions map[string]any - Origin *Origin + Origin *Origin `json:"-" yaml:"-"` Ref string Value *RequestBody @@ -744,7 +748,7 @@ func (x *RequestBodyRef) setRefPath(u *url.URL) { // MarshalYAML returns the YAML encoding of RequestBodyRef. func (x RequestBodyRef) MarshalYAML() (any, error) { if ref := x.Ref; ref != "" { - return &Ref{Ref: ref}, nil + return &Ref{Ref: ref, Extensions: x.Extensions}, nil } return x.Value.MarshalYAML() } @@ -765,11 +769,7 @@ func (x *RequestBodyRef) UnmarshalJSON(data []byte) error { x.Ref = refOnly.Ref x.Origin = refOnly.Origin if len(extra) != 0 { - x.extra = make([]string, 0, len(extra)) - for key := range extra { - x.extra = append(x.extra, key) - } - sort.Strings(x.extra) + x.extra = componentNames(extra) for k := range extra { if !strings.HasPrefix(k, "x-") { delete(extra, k) @@ -784,41 +784,46 @@ func (x *RequestBodyRef) UnmarshalJSON(data []byte) error { return json.Unmarshal(data, &x.Value) } -// Validate returns an error if RequestBodyRef does not comply with the OpenAPI spec. -func (x *RequestBodyRef) Validate(ctx context.Context, opts ...ValidationOption) error { - ctx = WithValidationOptions(ctx, opts...) - exProhibited := getValidationOptions(ctx).schemaExtensionsInRefProhibited +// validateExtras returns an error if RequestBodyRef has sibling fields +// alongside $ref that are not allowed by the validation options. +func (x *RequestBodyRef) validateExtras(ctx context.Context) error { + validationOpts := getValidationOptions(ctx) var extras []string - if extra := x.extra; len(extra) != 0 { - allowed := getValidationOptions(ctx).extraSiblingFieldsAllowed - for _, ex := range extra { - if allowed != nil { - if _, ok := allowed[ex]; ok { - continue - } - } - // extras in the Extensions checked below + + allowed := validationOpts.extraSiblingFieldsAllowed + if allowed == nil { + allowed = make(map[string]struct{}) + } + for _, ex := range x.extra { + if _, ok := allowed[ex]; !ok { if _, ok := x.Extensions[ex]; !ok { extras = append(extras, ex) } + // extras in the Extensions checked below } } - if extra := x.Extensions; exProhibited && len(extra) != 0 { - allowed := getValidationOptions(ctx).extraSiblingFieldsAllowed - for ex := range extra { - if allowed != nil { - if _, ok := allowed[ex]; ok { - continue - } + if validationOpts.schemaExtensionsInRefProhibited { + for _, ex := range componentNames(x.Extensions) { + if _, ok := allowed[ex]; !ok { + extras = append(extras, ex) } - extras = append(extras, ex) + // extras in the Extensions checked below } } if len(extras) != 0 { return fmt.Errorf("extra sibling fields: %+v", extras) } + return nil +} + +// Validate returns an error if RequestBodyRef does not comply with the OpenAPI spec. +func (x *RequestBodyRef) Validate(ctx context.Context, opts ...ValidationOption) error { + ctx = WithValidationOptions(ctx, opts...) + if err := x.validateExtras(ctx); err != nil { + return err + } if v := x.Value; v != nil { return v.Validate(ctx) @@ -847,7 +852,7 @@ type ResponseRef struct { // Extensions only captures fields starting with 'x-' as no other fields // are allowed by the openapi spec. Extensions map[string]any - Origin *Origin + Origin *Origin `json:"-" yaml:"-"` Ref string Value *Response @@ -882,7 +887,7 @@ func (x *ResponseRef) setRefPath(u *url.URL) { // MarshalYAML returns the YAML encoding of ResponseRef. func (x ResponseRef) MarshalYAML() (any, error) { if ref := x.Ref; ref != "" { - return &Ref{Ref: ref}, nil + return &Ref{Ref: ref, Extensions: x.Extensions}, nil } return x.Value.MarshalYAML() } @@ -903,11 +908,7 @@ func (x *ResponseRef) UnmarshalJSON(data []byte) error { x.Ref = refOnly.Ref x.Origin = refOnly.Origin if len(extra) != 0 { - x.extra = make([]string, 0, len(extra)) - for key := range extra { - x.extra = append(x.extra, key) - } - sort.Strings(x.extra) + x.extra = componentNames(extra) for k := range extra { if !strings.HasPrefix(k, "x-") { delete(extra, k) @@ -922,41 +923,46 @@ func (x *ResponseRef) UnmarshalJSON(data []byte) error { return json.Unmarshal(data, &x.Value) } -// Validate returns an error if ResponseRef does not comply with the OpenAPI spec. -func (x *ResponseRef) Validate(ctx context.Context, opts ...ValidationOption) error { - ctx = WithValidationOptions(ctx, opts...) - exProhibited := getValidationOptions(ctx).schemaExtensionsInRefProhibited +// validateExtras returns an error if ResponseRef has sibling fields +// alongside $ref that are not allowed by the validation options. +func (x *ResponseRef) validateExtras(ctx context.Context) error { + validationOpts := getValidationOptions(ctx) var extras []string - if extra := x.extra; len(extra) != 0 { - allowed := getValidationOptions(ctx).extraSiblingFieldsAllowed - for _, ex := range extra { - if allowed != nil { - if _, ok := allowed[ex]; ok { - continue - } - } - // extras in the Extensions checked below + + allowed := validationOpts.extraSiblingFieldsAllowed + if allowed == nil { + allowed = make(map[string]struct{}) + } + for _, ex := range x.extra { + if _, ok := allowed[ex]; !ok { if _, ok := x.Extensions[ex]; !ok { extras = append(extras, ex) } + // extras in the Extensions checked below } } - if extra := x.Extensions; exProhibited && len(extra) != 0 { - allowed := getValidationOptions(ctx).extraSiblingFieldsAllowed - for ex := range extra { - if allowed != nil { - if _, ok := allowed[ex]; ok { - continue - } + if validationOpts.schemaExtensionsInRefProhibited { + for _, ex := range componentNames(x.Extensions) { + if _, ok := allowed[ex]; !ok { + extras = append(extras, ex) } - extras = append(extras, ex) + // extras in the Extensions checked below } } if len(extras) != 0 { return fmt.Errorf("extra sibling fields: %+v", extras) } + return nil +} + +// Validate returns an error if ResponseRef does not comply with the OpenAPI spec. +func (x *ResponseRef) Validate(ctx context.Context, opts ...ValidationOption) error { + ctx = WithValidationOptions(ctx, opts...) + if err := x.validateExtras(ctx); err != nil { + return err + } if v := x.Value; v != nil { return v.Validate(ctx) @@ -985,11 +991,14 @@ type SchemaRef struct { // Extensions only captures fields starting with 'x-' as no other fields // are allowed by the openapi spec. Extensions map[string]any - Origin *Origin + Origin *Origin `json:"-" yaml:"-"` Ref string Value *Schema extra []string + // sibling holds keyword siblings of a $ref (OAS 3.1 / JSON Schema 2020-12). + // It is populated during unmarshal and applied to Value after $ref resolution. + sibling *Schema refPath *url.URL } @@ -1020,7 +1029,7 @@ func (x *SchemaRef) setRefPath(u *url.URL) { // MarshalYAML returns the YAML encoding of SchemaRef. func (x SchemaRef) MarshalYAML() (any, error) { if ref := x.Ref; ref != "" { - return &Ref{Ref: ref}, nil + return &Ref{Ref: ref, Extensions: x.Extensions}, nil } return x.Value.MarshalYAML() } @@ -1041,11 +1050,23 @@ func (x *SchemaRef) UnmarshalJSON(data []byte) error { x.Ref = refOnly.Ref x.Origin = refOnly.Origin if len(extra) != 0 { - x.extra = make([]string, 0, len(extra)) - for key := range extra { - x.extra = append(x.extra, key) + x.extra = componentNames(extra) + // OAS 3.1 / JSON Schema 2020-12: sibling keywords alongside $ref are valid + // and must be merged with the resolved reference. Parse the full object so + // the sibling fields are available after $ref resolution in resolveSchemaRef. + hasSiblings := false + for k := range extra { + if !strings.HasPrefix(k, "x-") { + hasSiblings = true + break + } + } + if hasSiblings { + var sibling Schema + if err := json.Unmarshal(data, &sibling); err == nil { + x.sibling = &sibling + } } - sort.Strings(x.extra) for k := range extra { if !strings.HasPrefix(k, "x-") { delete(extra, k) @@ -1060,40 +1081,47 @@ func (x *SchemaRef) UnmarshalJSON(data []byte) error { return json.Unmarshal(data, &x.Value) } -// Validate returns an error if SchemaRef does not comply with the OpenAPI spec. -func (x *SchemaRef) Validate(ctx context.Context, opts ...ValidationOption) error { - ctx = WithValidationOptions(ctx, opts...) - exProhibited := getValidationOptions(ctx).schemaExtensionsInRefProhibited +// validateExtras returns an error if SchemaRef has sibling fields +// alongside $ref that are not allowed by the validation options. +func (x *SchemaRef) validateExtras(ctx context.Context) error { + validationOpts := getValidationOptions(ctx) var extras []string - if extra := x.extra; len(extra) != 0 { - allowed := getValidationOptions(ctx).extraSiblingFieldsAllowed - for _, ex := range extra { - if allowed != nil { - if _, ok := allowed[ex]; ok { - continue - } - } - // extras in the Extensions checked below + + allowed := validationOpts.extraSiblingFieldsAllowed + if allowed == nil { + allowed = make(map[string]struct{}) + } + for _, ex := range x.extra { + if _, ok := allowed[ex]; !ok { if _, ok := x.Extensions[ex]; !ok { extras = append(extras, ex) } + // extras in the Extensions checked below } } - if extra := x.Extensions; exProhibited && len(extra) != 0 { - allowed := getValidationOptions(ctx).extraSiblingFieldsAllowed - for ex := range extra { - if allowed != nil { - if _, ok := allowed[ex]; ok { - continue - } + if validationOpts.schemaExtensionsInRefProhibited { + for _, ex := range componentNames(x.Extensions) { + if _, ok := allowed[ex]; !ok { + extras = append(extras, ex) } - extras = append(extras, ex) + // extras in the Extensions checked below } } if len(extras) != 0 { - return fmt.Errorf("extra sibling fields: %+v", extras) + if !validationOpts.isOpenAPI31OrLater { + return fmt.Errorf("extra sibling fields: %+v", extras) + } + } + return nil +} + +// Validate returns an error if SchemaRef does not comply with the OpenAPI spec. +func (x *SchemaRef) Validate(ctx context.Context, opts ...ValidationOption) error { + ctx = WithValidationOptions(ctx, opts...) + if err := x.validateExtras(ctx); err != nil { + return err } if v := x.Value; v != nil { @@ -1123,7 +1151,7 @@ type SecuritySchemeRef struct { // Extensions only captures fields starting with 'x-' as no other fields // are allowed by the openapi spec. Extensions map[string]any - Origin *Origin + Origin *Origin `json:"-" yaml:"-"` Ref string Value *SecurityScheme @@ -1158,7 +1186,7 @@ func (x *SecuritySchemeRef) setRefPath(u *url.URL) { // MarshalYAML returns the YAML encoding of SecuritySchemeRef. func (x SecuritySchemeRef) MarshalYAML() (any, error) { if ref := x.Ref; ref != "" { - return &Ref{Ref: ref}, nil + return &Ref{Ref: ref, Extensions: x.Extensions}, nil } return x.Value.MarshalYAML() } @@ -1179,11 +1207,7 @@ func (x *SecuritySchemeRef) UnmarshalJSON(data []byte) error { x.Ref = refOnly.Ref x.Origin = refOnly.Origin if len(extra) != 0 { - x.extra = make([]string, 0, len(extra)) - for key := range extra { - x.extra = append(x.extra, key) - } - sort.Strings(x.extra) + x.extra = componentNames(extra) for k := range extra { if !strings.HasPrefix(k, "x-") { delete(extra, k) @@ -1198,41 +1222,46 @@ func (x *SecuritySchemeRef) UnmarshalJSON(data []byte) error { return json.Unmarshal(data, &x.Value) } -// Validate returns an error if SecuritySchemeRef does not comply with the OpenAPI spec. -func (x *SecuritySchemeRef) Validate(ctx context.Context, opts ...ValidationOption) error { - ctx = WithValidationOptions(ctx, opts...) - exProhibited := getValidationOptions(ctx).schemaExtensionsInRefProhibited +// validateExtras returns an error if SecuritySchemeRef has sibling fields +// alongside $ref that are not allowed by the validation options. +func (x *SecuritySchemeRef) validateExtras(ctx context.Context) error { + validationOpts := getValidationOptions(ctx) var extras []string - if extra := x.extra; len(extra) != 0 { - allowed := getValidationOptions(ctx).extraSiblingFieldsAllowed - for _, ex := range extra { - if allowed != nil { - if _, ok := allowed[ex]; ok { - continue - } - } - // extras in the Extensions checked below + + allowed := validationOpts.extraSiblingFieldsAllowed + if allowed == nil { + allowed = make(map[string]struct{}) + } + for _, ex := range x.extra { + if _, ok := allowed[ex]; !ok { if _, ok := x.Extensions[ex]; !ok { extras = append(extras, ex) } + // extras in the Extensions checked below } } - if extra := x.Extensions; exProhibited && len(extra) != 0 { - allowed := getValidationOptions(ctx).extraSiblingFieldsAllowed - for ex := range extra { - if allowed != nil { - if _, ok := allowed[ex]; ok { - continue - } + if validationOpts.schemaExtensionsInRefProhibited { + for _, ex := range componentNames(x.Extensions) { + if _, ok := allowed[ex]; !ok { + extras = append(extras, ex) } - extras = append(extras, ex) + // extras in the Extensions checked below } } if len(extras) != 0 { return fmt.Errorf("extra sibling fields: %+v", extras) } + return nil +} + +// Validate returns an error if SecuritySchemeRef does not comply with the OpenAPI spec. +func (x *SecuritySchemeRef) Validate(ctx context.Context, opts ...ValidationOption) error { + ctx = WithValidationOptions(ctx, opts...) + if err := x.validateExtras(ctx); err != nil { + return err + } if v := x.Value; v != nil { return v.Validate(ctx) diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/refs.tmpl b/vendor/github.com/getkin/kin-openapi/openapi3/refs.tmpl index 028deba..36db575 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/refs.tmpl +++ b/vendor/github.com/getkin/kin-openapi/openapi3/refs.tmpl @@ -1,4 +1,4 @@ -// Code generated by go generate; DO NOT EDIT. +// Code generated by go generate using refs.tmpl; DO NOT EDIT refs.go. package {{ .Package }} import ( @@ -6,7 +6,6 @@ import ( "encoding/json" "fmt" "net/url" - "sort" "strings" "github.com/go-openapi/jsonpointer" @@ -19,11 +18,16 @@ type {{ $type.Name }}Ref struct { // Extensions only captures fields starting with 'x-' as no other fields // are allowed by the openapi spec. Extensions map[string]any - Origin *Origin + Origin *Origin `json:"-" yaml:"-"` Ref string Value *{{ $type.Name }} extra []string +{{- if eq $type.Name "Schema" }} + // sibling holds keyword siblings of a $ref (OAS 3.1 / JSON Schema 2020-12). + // It is populated during unmarshal and applied to Value after $ref resolution. + sibling *Schema +{{- end }} refPath *url.URL } @@ -54,7 +58,7 @@ func (x *{{ $type.Name }}Ref) setRefPath(u *url.URL) { // MarshalYAML returns the YAML encoding of {{ $type.Name }}Ref. func (x {{ $type.Name }}Ref) MarshalYAML() (any, error) { if ref := x.Ref; ref != "" { - return &Ref{Ref: ref}, nil + return &Ref{Ref: ref, Extensions: x.Extensions}, nil } return x.Value.MarshalYAML() } @@ -75,11 +79,25 @@ func (x *{{ $type.Name }}Ref) UnmarshalJSON(data []byte) error { x.Ref = refOnly.Ref x.Origin = refOnly.Origin if len(extra) != 0 { - x.extra = make([]string, 0, len(extra)) - for key := range extra { - x.extra = append(x.extra, key) + x.extra = componentNames(extra) +{{- if eq $type.Name "Schema" }} + // OAS 3.1 / JSON Schema 2020-12: sibling keywords alongside $ref are valid + // and must be merged with the resolved reference. Parse the full object so + // the sibling fields are available after $ref resolution in resolveSchemaRef. + hasSiblings := false + for k := range extra { + if !strings.HasPrefix(k, "x-") { + hasSiblings = true + break + } } - sort.Strings(x.extra) + if hasSiblings { + var sibling Schema + if err := json.Unmarshal(data, &sibling); err == nil { + x.sibling = &sibling + } + } +{{- end }} for k := range extra { if !strings.HasPrefix(k, "x-") { delete(extra, k) @@ -94,40 +112,51 @@ func (x *{{ $type.Name }}Ref) UnmarshalJSON(data []byte) error { return json.Unmarshal(data, &x.Value) } -// Validate returns an error if {{ $type.Name }}Ref does not comply with the OpenAPI spec. -func (x *{{ $type.Name }}Ref) Validate(ctx context.Context, opts ...ValidationOption) error { - ctx = WithValidationOptions(ctx, opts...) - exProhibited := getValidationOptions(ctx).schemaExtensionsInRefProhibited +// validateExtras returns an error if {{ $type.Name }}Ref has sibling fields +// alongside $ref that are not allowed by the validation options. +func (x *{{ $type.Name }}Ref) validateExtras(ctx context.Context) error { + validationOpts := getValidationOptions(ctx) var extras []string - if extra := x.extra; len(extra) != 0 { - allowed := getValidationOptions(ctx).extraSiblingFieldsAllowed - for _, ex := range extra { - if allowed != nil { - if _, ok := allowed[ex]; ok { - continue - } - } - // extras in the Extensions checked below + + allowed := validationOpts.extraSiblingFieldsAllowed + if allowed == nil { + allowed = make(map[string]struct{}) + } + for _, ex := range x.extra { + if _, ok := allowed[ex]; !ok { if _, ok := x.Extensions[ex]; !ok { extras = append(extras, ex) } + // extras in the Extensions checked below } } - if extra := x.Extensions; exProhibited && len(extra) != 0 { - allowed := getValidationOptions(ctx).extraSiblingFieldsAllowed - for ex := range extra { - if allowed != nil { - if _, ok := allowed[ex]; ok { - continue - } + if validationOpts.schemaExtensionsInRefProhibited { + for _, ex := range componentNames(x.Extensions) { + if _, ok := allowed[ex]; !ok { + extras = append(extras, ex) } - extras = append(extras, ex) + // extras in the Extensions checked below } } if len(extras) != 0 { +{{- if eq $type.Name "Schema" }} + if !validationOpts.isOpenAPI31OrLater { + return fmt.Errorf("extra sibling fields: %+v", extras) + } +{{- else }} return fmt.Errorf("extra sibling fields: %+v", extras) +{{- end }} + } + return nil +} + +// Validate returns an error if {{ $type.Name }}Ref does not comply with the OpenAPI spec. +func (x *{{ $type.Name }}Ref) Validate(ctx context.Context, opts ...ValidationOption) error { + ctx = WithValidationOptions(ctx, opts...) + if err := x.validateExtras(ctx); err != nil { + return err } if v := x.Value; v != nil { diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/refs_test.tmpl b/vendor/github.com/getkin/kin-openapi/openapi3/refs_test.tmpl index 634fccf..6ddacb6 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/refs_test.tmpl +++ b/vendor/github.com/getkin/kin-openapi/openapi3/refs_test.tmpl @@ -2,7 +2,6 @@ package {{ .Package }} import ( - "context" "encoding/json" "testing" @@ -12,6 +11,7 @@ import ( {{ range $type := .Types }} func Test{{ $type.Name }}Ref_Extensions(t *testing.T) { data := []byte(`{"$ref":"#/components/schemas/Pet","something":"integer","x-order":1}`) + expectMarshalJson := []byte(`{"$ref":"#/components/schemas/Pet","x-order":1}`) ref := {{ $type.Name }}Ref{} err := json.Unmarshal(data, &ref) @@ -25,15 +25,21 @@ func Test{{ $type.Name }}Ref_Extensions(t *testing.T) { assert.Nil(t, ref.Extensions["something"]) // validation - err = ref.Validate(context.Background()) + err = ref.Validate(t.Context()) require.EqualError(t, err, "extra sibling fields: [something]") - err = ref.Validate(context.Background(), ProhibitExtensionsWithRef()) + err = ref.Validate(t.Context(), ProhibitExtensionsWithRef()) require.EqualError(t, err, "extra sibling fields: [something x-order]") - err = ref.Validate(context.Background(), AllowExtraSiblingFields("something")) + err = ref.Validate(t.Context(), AllowExtraSiblingFields("something")) assert.ErrorContains(t, err, "found unresolved ref") // expected since value not defined + // Verify round trip JSON + // Compare as string to make error message more readable if different + outJson, err := ref.MarshalJSON() + assert.NoError(t, err) + assert.Equal(t, string(outJson), string(expectMarshalJson), "MarshalJSON output is not the same as input data") + // non-extension not json lookable _, err = ref.JSONLookup("something") assert.Error(t, err) diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/request_body.go b/vendor/github.com/getkin/kin-openapi/openapi3/request_body.go index 6c15ba0..e44942e 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/request_body.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/request_body.go @@ -4,13 +4,14 @@ import ( "context" "encoding/json" "errors" + "maps" ) // RequestBody is specified by OpenAPI/Swagger 3.0 standard. // See https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.0.3.md#request-body-object type RequestBody struct { Extensions map[string]any `json:"-" yaml:"-"` - Origin *Origin `json:"__origin__,omitempty" yaml:"__origin__,omitempty"` + Origin *Origin `json:"-" yaml:"-"` Description string `json:"description,omitempty" yaml:"description,omitempty"` Required bool `json:"required,omitempty" yaml:"required,omitempty"` @@ -86,9 +87,7 @@ func (requestBody RequestBody) MarshalJSON() ([]byte, error) { // MarshalYAML returns the YAML encoding of RequestBody. func (requestBody RequestBody) MarshalYAML() (any, error) { m := make(map[string]any, 3+len(requestBody.Extensions)) - for k, v := range requestBody.Extensions { - m[k] = v - } + maps.Copy(m, requestBody.Extensions) if x := requestBody.Description; x != "" { m["description"] = requestBody.Description } @@ -109,7 +108,6 @@ func (requestBody *RequestBody) UnmarshalJSON(data []byte) error { return unmarshalError(err) } _ = json.Unmarshal(data, &x.Extensions) - delete(x.Extensions, originKey) delete(x.Extensions, "description") delete(x.Extensions, "required") delete(x.Extensions, "content") @@ -141,6 +139,6 @@ func (requestBody *RequestBody) Validate(ctx context.Context, opts ...Validation // UnmarshalJSON sets RequestBodies to a copy of data. func (requestBodies *RequestBodies) UnmarshalJSON(data []byte) (err error) { - *requestBodies, _, err = unmarshalStringMapP[RequestBodyRef](data) + *requestBodies, err = unmarshalStringMapP[RequestBodyRef](data) return } diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/response.go b/vendor/github.com/getkin/kin-openapi/openapi3/response.go index b87324a..4cfd0ee 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/response.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/response.go @@ -4,7 +4,7 @@ import ( "context" "encoding/json" "errors" - "sort" + "maps" "strconv" ) @@ -18,11 +18,8 @@ type Responses struct { } // NewResponses builds a responses object with response objects in insertion order. -// Given no arguments, NewResponses returns a valid responses object containing a default match-all reponse. +// Given no arguments, NewResponses returns an empty responses object. func NewResponses(opts ...NewResponsesOption) *Responses { - if len(opts) == 0 { - return NewResponses(WithName("default", NewResponse().WithDescription(""))) - } responses := NewResponsesWithCapacity(len(opts)) for _, opt := range opts { opt(responses) @@ -84,12 +81,7 @@ func (responses *Responses) Validate(ctx context.Context, opts ...ValidationOpti return errors.New("the responses object MUST contain at least one response code") } - keys := make([]string, 0, responses.Len()) - for key := range responses.Map() { - keys = append(keys, key) - } - sort.Strings(keys) - for _, key := range keys { + for _, key := range responses.Keys() { v := responses.Value(key) if err := v.Validate(ctx); err != nil { return err @@ -103,7 +95,7 @@ func (responses *Responses) Validate(ctx context.Context, opts ...ValidationOpti // See https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.0.3.md#response-object type Response struct { Extensions map[string]any `json:"-" yaml:"-"` - Origin *Origin `json:"__origin__,omitempty" yaml:"__origin__,omitempty"` + Origin *Origin `json:"-" yaml:"-"` Description *string `json:"description,omitempty" yaml:"description,omitempty"` Headers Headers `json:"headers,omitempty" yaml:"headers,omitempty"` @@ -147,9 +139,7 @@ func (response Response) MarshalJSON() ([]byte, error) { // MarshalYAML returns the YAML encoding of Response. func (response Response) MarshalYAML() (any, error) { m := make(map[string]any, 4+len(response.Extensions)) - for k, v := range response.Extensions { - m[k] = v - } + maps.Copy(m, response.Extensions) if x := response.Description; x != nil { m["description"] = x } @@ -173,7 +163,6 @@ func (response *Response) UnmarshalJSON(data []byte) error { return unmarshalError(err) } _ = json.Unmarshal(data, &x.Extensions) - delete(x.Extensions, originKey) delete(x.Extensions, "description") delete(x.Extensions, "headers") delete(x.Extensions, "content") @@ -202,24 +191,14 @@ func (response *Response) Validate(ctx context.Context, opts ...ValidationOption } } - headers := make([]string, 0, len(response.Headers)) - for name := range response.Headers { - headers = append(headers, name) - } - sort.Strings(headers) - for _, name := range headers { + for _, name := range componentNames(response.Headers) { header := response.Headers[name] if err := header.Validate(ctx); err != nil { return err } } - links := make([]string, 0, len(response.Links)) - for name := range response.Links { - links = append(links, name) - } - sort.Strings(links) - for _, name := range links { + for _, name := range componentNames(response.Links) { link := response.Links[name] if err := link.Validate(ctx); err != nil { return err @@ -231,6 +210,6 @@ func (response *Response) Validate(ctx context.Context, opts ...ValidationOption // UnmarshalJSON sets ResponseBodies to a copy of data. func (responseBodies *ResponseBodies) UnmarshalJSON(data []byte) (err error) { - *responseBodies, _, err = unmarshalStringMapP[ResponseRef](data) + *responseBodies, err = unmarshalStringMapP[ResponseRef](data) return } diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/schema.go b/vendor/github.com/getkin/kin-openapi/openapi3/schema.go index d76bef4..75def44 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/schema.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/schema.go @@ -6,10 +6,11 @@ import ( "encoding/json" "errors" "fmt" + "maps" "math" "math/big" "reflect" - "sort" + "slices" "strconv" "strings" "sync" @@ -80,9 +81,10 @@ func (s SchemaRefs) JSONLookup(token string) (any, error) { // Schema is specified by OpenAPI/Swagger 3.0 standard. // See https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.0.3.md#schema-object +// and https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.1.0.md#schema-object type Schema struct { Extensions map[string]any `json:"-" yaml:"-"` - Origin *Origin `json:"__origin__,omitempty" yaml:"__origin__,omitempty"` + Origin *Origin `json:"-" yaml:"-"` OneOf SchemaRefs `json:"oneOf,omitempty" yaml:"oneOf,omitempty"` AnyOf SchemaRefs `json:"anyOf,omitempty" yaml:"anyOf,omitempty"` @@ -100,8 +102,8 @@ type Schema struct { // Array-related, here for struct compactness UniqueItems bool `json:"uniqueItems,omitempty" yaml:"uniqueItems,omitempty"` // Number-related, here for struct compactness - ExclusiveMin bool `json:"exclusiveMinimum,omitempty" yaml:"exclusiveMinimum,omitempty"` - ExclusiveMax bool `json:"exclusiveMaximum,omitempty" yaml:"exclusiveMaximum,omitempty"` + ExclusiveMin ExclusiveBound `json:"exclusiveMinimum,omitempty" yaml:"exclusiveMinimum,omitempty"` // Number for v3.1+ otherwise boolean + ExclusiveMax ExclusiveBound `json:"exclusiveMaximum,omitempty" yaml:"exclusiveMaximum,omitempty"` // Number for v3.1+ otherwise boolean // Properties Nullable bool `json:"nullable,omitempty" yaml:"nullable,omitempty"` ReadOnly bool `json:"readOnly,omitempty" yaml:"readOnly,omitempty"` @@ -132,14 +134,82 @@ type Schema struct { MaxProps *uint64 `json:"maxProperties,omitempty" yaml:"maxProperties,omitempty"` AdditionalProperties AdditionalProperties `json:"additionalProperties,omitempty" yaml:"additionalProperties,omitempty"` Discriminator *Discriminator `json:"discriminator,omitempty" yaml:"discriminator,omitempty"` -} + Const any `json:"const,omitempty" yaml:"const,omitempty"` // OpenAPI >=3.1 + Examples []any `json:"examples,omitempty" yaml:"examples,omitempty"` // OpenAPI >=3.1 + PrefixItems SchemaRefs `json:"prefixItems,omitempty" yaml:"prefixItems,omitempty"` // OpenAPI >=3.1 + Contains *SchemaRef `json:"contains,omitempty" yaml:"contains,omitempty"` // OpenAPI >=3.1 + MinContains *uint64 `json:"minContains,omitempty" yaml:"minContains,omitempty"` // OpenAPI >=3.1 + MaxContains *uint64 `json:"maxContains,omitempty" yaml:"maxContains,omitempty"` // OpenAPI >=3.1 + PatternProperties Schemas `json:"patternProperties,omitempty" yaml:"patternProperties,omitempty"` // OpenAPI >=3.1 + DependentSchemas Schemas `json:"dependentSchemas,omitempty" yaml:"dependentSchemas,omitempty"` // OpenAPI >=3.1 + PropertyNames *SchemaRef `json:"propertyNames,omitempty" yaml:"propertyNames,omitempty"` // OpenAPI >=3.1 + UnevaluatedItems BoolSchema `json:"unevaluatedItems,omitempty" yaml:"unevaluatedItems,omitempty"` // OpenAPI >=3.1 + UnevaluatedProperties BoolSchema `json:"unevaluatedProperties,omitempty" yaml:"unevaluatedProperties,omitempty"` // OpenAPI >=3.1 + + If *SchemaRef `json:"if,omitempty" yaml:"if,omitempty"` // OpenAPI >=3.1 + Then *SchemaRef `json:"then,omitempty" yaml:"then,omitempty"` // OpenAPI >=3.1 + Else *SchemaRef `json:"else,omitempty" yaml:"else,omitempty"` // OpenAPI >=3.1 + + DependentRequired map[string][]string `json:"dependentRequired,omitempty" yaml:"dependentRequired,omitempty"` // OpenAPI >=3.1 + + Defs Schemas `json:"$defs,omitempty" yaml:"$defs,omitempty"` // OpenAPI >=3.1 + SchemaDialect string `json:"$schema,omitempty" yaml:"$schema,omitempty"` // OpenAPI >=3.1 + Comment string `json:"$comment,omitempty" yaml:"$comment,omitempty"` // OpenAPI >=3.1 + + SchemaID string `json:"$id,omitempty" yaml:"$id,omitempty"` // OpenAPI >=3.1 + Anchor string `json:"$anchor,omitempty" yaml:"$anchor,omitempty"` // OpenAPI >=3.1 + DynamicRef string `json:"$dynamicRef,omitempty" yaml:"$dynamicRef,omitempty"` // OpenAPI >=3.1 + DynamicAnchor string `json:"$dynamicAnchor,omitempty" yaml:"$dynamicAnchor,omitempty"` // OpenAPI >=3.1 + + ContentMediaType string `json:"contentMediaType,omitempty" yaml:"contentMediaType,omitempty"` // OpenAPI >=3.1 + ContentEncoding string `json:"contentEncoding,omitempty" yaml:"contentEncoding,omitempty"` // OpenAPI >=3.1 + ContentSchema *SchemaRef `json:"contentSchema,omitempty" yaml:"contentSchema,omitempty"` // OpenAPI >=3.1 +} + +// Types represents the type(s) of a schema. +// +// In OpenAPI 3.0, this is typically a single type (e.g., "string"). +// In OpenAPI 3.1, it can be an array of types (e.g., ["string", "null"]). +// +// Serialization behavior: +// - Single type: serializes as a string (e.g., "string") +// - Multiple types: serializes as an array (e.g., ["string", "null"]) +// - Accepts both string and array formats when unmarshaling +// +// Example OpenAPI 3.0 (single type): +// +// schema := &Schema{Type: &Types{"string"}} +// // JSON: {"type": "string"} +// +// Example OpenAPI 3.1 (type array): +// +// schema := &Schema{Type: &Types{"string", "null"}} +// // JSON: {"type": ["string", "null"]} type Types []string +// Is returns true if the schema has exactly one type and it matches the given type. +// This is useful for OpenAPI 3.0 style single-type checks. +// +// Example: +// +// types := &Types{"string"} +// types.Is("string") // true +// types.Is("number") // false +// +// types = &Types{"string", "null"} +// types.Is("string") // false (multiple types) func (types *Types) Is(typ string) bool { return types != nil && len(*types) == 1 && (*types)[0] == typ } +// Slice returns the types as a string slice. +// Returns nil if types is nil. +// +// Example: +// +// types := &Types{"string", "null"} +// slice := types.Slice() // []string{"string", "null"} func (types *Types) Slice() []string { if types == nil { return nil @@ -147,19 +217,33 @@ func (types *Types) Slice() []string { return *types } +// Includes returns true if the given type is included in the type array. +// Returns false if types is nil. +// +// Example: +// +// types := &Types{"string", "null"} +// types.Includes("string") // true +// types.Includes("null") // true +// types.Includes("number") // false func (pTypes *Types) Includes(typ string) bool { if pTypes == nil { return false } - types := *pTypes - for _, candidate := range types { - if candidate == typ { - return true - } - } - return false + return slices.Contains(*pTypes, typ) } +// Permits returns true if the given type is permitted. +// Returns true if types is nil (any type allowed), otherwise checks if the type is included. +// +// Example: +// +// var nilTypes *Types +// nilTypes.Permits("anything") // true (nil permits everything) +// +// types := &Types{"string"} +// types.Permits("string") // true +// types.Permits("number") // false func (types *Types) Permits(typ string) bool { if types == nil { return true @@ -167,6 +251,64 @@ func (types *Types) Permits(typ string) bool { return types.Includes(typ) } +// IncludesNull returns true if the type array includes "null". +// This is useful for OpenAPI 3.1 where null is a first-class type. +// +// Example: +// +// types := &Types{"string", "null"} +// types.IncludesNull() // true +// +// types = &Types{"string"} +// types.IncludesNull() // false +func (types *Types) IncludesNull() bool { + return types.Includes(TypeNull) +} + +// IsMultiple returns true if multiple types are specified. +// This is an OpenAPI 3.1 feature that enables type arrays. +// +// Example: +// +// types := &Types{"string"} +// types.IsMultiple() // false +// +// types = &Types{"string", "null"} +// types.IsMultiple() // true +func (types *Types) IsMultiple() bool { + return types != nil && len(*types) > 1 +} + +// IsSingle returns true if exactly one type is specified. +// +// Example: +// +// types := &Types{"string"} +// types.IsSingle() // true +// +// types = &Types{"string", "null"} +// types.IsSingle() // false +func (types *Types) IsSingle() bool { + return types != nil && len(*types) == 1 +} + +// IsEmpty returns true if no types are specified (nil or empty array). +// When a schema has no type specified, it permits any type. +// +// Example: +// +// var nilTypes *Types +// nilTypes.IsEmpty() // true +// +// types := &Types{} +// types.IsEmpty() // true +// +// types = &Types{"string"} +// types.IsEmpty() // false +func (types *Types) IsEmpty() bool { + return types == nil || len(*types) == 0 +} + func (pTypes *Types) MarshalJSON() ([]byte, error) { x, err := pTypes.MarshalYAML() if err != nil { @@ -203,36 +345,41 @@ func (types *Types) UnmarshalJSON(data []byte) error { return nil } -type AdditionalProperties struct { +// BoolSchema represents a JSON Schema keyword that can be either a boolean or a schema object. +// Used for additionalProperties, unevaluatedProperties, and unevaluatedItems. +type BoolSchema struct { Has *bool Schema *SchemaRef } -// MarshalYAML returns the YAML encoding of AdditionalProperties. -func (addProps AdditionalProperties) MarshalYAML() (any, error) { - if x := addProps.Has; x != nil { +// AdditionalProperties is a type alias for BoolSchema, kept for backward compatibility. +type AdditionalProperties = BoolSchema + +// MarshalYAML returns the YAML encoding of BoolSchema. +func (bs BoolSchema) MarshalYAML() (any, error) { + if x := bs.Has; x != nil { if *x { return true, nil } return false, nil } - if x := addProps.Schema; x != nil { + if x := bs.Schema; x != nil { return x.MarshalYAML() } return nil, nil } -// MarshalJSON returns the JSON encoding of AdditionalProperties. -func (addProps AdditionalProperties) MarshalJSON() ([]byte, error) { - x, err := addProps.MarshalYAML() +// MarshalJSON returns the JSON encoding of BoolSchema. +func (bs BoolSchema) MarshalJSON() ([]byte, error) { + x, err := bs.MarshalYAML() if err != nil { return nil, err } return json.Marshal(x) } -// UnmarshalJSON sets AdditionalProperties to a copy of data. -func (addProps *AdditionalProperties) UnmarshalJSON(data []byte) error { +// UnmarshalJSON sets BoolSchema to a copy of data. +func (bs *BoolSchema) UnmarshalJSON(data []byte) error { var x any if err := json.Unmarshal(data, &x); err != nil { return unmarshalError(err) @@ -240,19 +387,79 @@ func (addProps *AdditionalProperties) UnmarshalJSON(data []byte) error { switch y := x.(type) { case nil: case bool: - addProps.Has = &y + bs.Has = &y case map[string]any: if len(y) == 0 { - addProps.Schema = &SchemaRef{Value: &Schema{}} + bs.Schema = &SchemaRef{Value: &Schema{}} } else { buf := new(bytes.Buffer) _ = json.NewEncoder(buf).Encode(y) - if err := json.NewDecoder(buf).Decode(&addProps.Schema); err != nil { + if err := json.NewDecoder(buf).Decode(&bs.Schema); err != nil { return err } } default: - return errors.New("cannot unmarshal additionalProperties: value must be either a schema object or a boolean") + return errors.New("cannot unmarshal: value must be either a schema object or a boolean") + } + return nil +} + +// ExclusiveBound represents exclusiveMinimum/exclusiveMaximum which changed type between OpenAPI versions. +// In OpenAPI 3.0 (JSON Schema draft-04): boolean that modifies minimum/maximum +// In OpenAPI 3.1 (JSON Schema 2020-12): number representing the actual exclusive bound +type ExclusiveBound struct { + Bool *bool // For OpenAPI 3.0 style (modifier for min/max) + Value *float64 // For OpenAPI 3.1 style (actual bound value) +} + +// IsSet returns true if either Bool or Value is set. +func (eb ExclusiveBound) IsSet() bool { + return eb.Bool != nil || eb.Value != nil +} + +// IsTrue returns true if the bound is set as a boolean true (OpenAPI 3.0 style). +func (eb ExclusiveBound) IsTrue() bool { + return eb.Bool != nil && *eb.Bool +} + +// MarshalYAML returns the YAML encoding of ExclusiveBound. +func (eb ExclusiveBound) MarshalYAML() (any, error) { + if eb.Value != nil { + return *eb.Value, nil + } + if eb.Bool != nil { + return *eb.Bool, nil + } + return nil, nil +} + +// MarshalJSON returns the JSON encoding of ExclusiveBound. +func (eb ExclusiveBound) MarshalJSON() ([]byte, error) { + x, err := eb.MarshalYAML() + if err != nil { + return nil, err + } + if x == nil { + return nil, nil + } + return json.Marshal(x) +} + +// UnmarshalJSON sets ExclusiveBound to a copy of data. +func (eb *ExclusiveBound) UnmarshalJSON(data []byte) error { + var x any + if err := json.Unmarshal(data, &x); err != nil { + return unmarshalError(err) + } + switch y := x.(type) { + case nil: + // nothing to do + case bool: + eb.Bool = &y + case float64: + eb.Value = &y + default: + return errors.New("cannot unmarshal exclusiveMinimum/exclusiveMaximum: value must be either a number or a boolean") } return nil } @@ -275,10 +482,8 @@ func (schema Schema) MarshalJSON() ([]byte, error) { // MarshalYAML returns the YAML encoding of Schema. func (schema Schema) MarshalYAML() (any, error) { - m := make(map[string]any, 36+len(schema.Extensions)) - for k, v := range schema.Extensions { - m[k] = v - } + m := make(map[string]any, 61+len(schema.Extensions)) + maps.Copy(m, schema.Extensions) if x := schema.OneOf; len(x) != 0 { m["oneOf"] = x @@ -322,10 +527,10 @@ func (schema Schema) MarshalYAML() (any, error) { m["uniqueItems"] = x } // Number-related - if x := schema.ExclusiveMin; x { + if x := schema.ExclusiveMin; x.IsSet() { m["exclusiveMinimum"] = x } - if x := schema.ExclusiveMax; x { + if x := schema.ExclusiveMax; x.IsSet() { m["exclusiveMaximum"] = x } // Properties @@ -401,6 +606,83 @@ func (schema Schema) MarshalYAML() (any, error) { m["discriminator"] = x } + // OpenAPI 3.1 / JSON Schema 2020-12 fields + if x := schema.Const; x != nil { + m["const"] = x + } + if x := schema.Examples; len(x) != 0 { + m["examples"] = x + } + if x := schema.PrefixItems; len(x) != 0 { + m["prefixItems"] = x + } + if x := schema.Contains; x != nil { + m["contains"] = x + } + if x := schema.MinContains; x != nil { + m["minContains"] = x + } + if x := schema.MaxContains; x != nil { + m["maxContains"] = x + } + if x := schema.PatternProperties; len(x) != 0 { + m["patternProperties"] = x + } + if x := schema.DependentSchemas; len(x) != 0 { + m["dependentSchemas"] = x + } + if x := schema.PropertyNames; x != nil { + m["propertyNames"] = x + } + if x := schema.UnevaluatedItems; x.Has != nil || x.Schema != nil { + m["unevaluatedItems"] = &x + } + if x := schema.UnevaluatedProperties; x.Has != nil || x.Schema != nil { + m["unevaluatedProperties"] = &x + } + if x := schema.If; x != nil { + m["if"] = x + } + if x := schema.Then; x != nil { + m["then"] = x + } + if x := schema.Else; x != nil { + m["else"] = x + } + if x := schema.DependentRequired; len(x) != 0 { + m["dependentRequired"] = x + } + if x := schema.Defs; len(x) != 0 { + m["$defs"] = x + } + if x := schema.SchemaDialect; x != "" { + m["$schema"] = x + } + if x := schema.Comment; x != "" { + m["$comment"] = x + } + if x := schema.SchemaID; x != "" { + m["$id"] = x + } + if x := schema.Anchor; x != "" { + m["$anchor"] = x + } + if x := schema.DynamicRef; x != "" { + m["$dynamicRef"] = x + } + if x := schema.DynamicAnchor; x != "" { + m["$dynamicAnchor"] = x + } + if x := schema.ContentMediaType; x != "" { + m["contentMediaType"] = x + } + if x := schema.ContentEncoding; x != "" { + m["contentEncoding"] = x + } + if x := schema.ContentSchema; x != nil { + m["contentSchema"] = x + } + return m, nil } @@ -413,7 +695,6 @@ func (schema *Schema) UnmarshalJSON(data []byte) error { } _ = json.Unmarshal(data, &x.Extensions) - delete(x.Extensions, originKey) delete(x.Extensions, "oneOf") delete(x.Extensions, "anyOf") delete(x.Extensions, "allOf") @@ -463,6 +744,33 @@ func (schema *Schema) UnmarshalJSON(data []byte) error { delete(x.Extensions, "additionalProperties") delete(x.Extensions, "discriminator") + // OpenAPI 3.1 / JSON Schema 2020-12 fields + delete(x.Extensions, "const") + delete(x.Extensions, "examples") + delete(x.Extensions, "prefixItems") + delete(x.Extensions, "contains") + delete(x.Extensions, "minContains") + delete(x.Extensions, "maxContains") + delete(x.Extensions, "patternProperties") + delete(x.Extensions, "dependentSchemas") + delete(x.Extensions, "propertyNames") + delete(x.Extensions, "unevaluatedItems") + delete(x.Extensions, "unevaluatedProperties") + delete(x.Extensions, "if") + delete(x.Extensions, "then") + delete(x.Extensions, "else") + delete(x.Extensions, "dependentRequired") + delete(x.Extensions, "$defs") + delete(x.Extensions, "$schema") + delete(x.Extensions, "$comment") + delete(x.Extensions, "$id") + delete(x.Extensions, "$anchor") + delete(x.Extensions, "$dynamicRef") + delete(x.Extensions, "$dynamicAnchor") + delete(x.Extensions, "contentMediaType") + delete(x.Extensions, "contentEncoding") + delete(x.Extensions, "contentSchema") + if len(x.Extensions) == 0 { x.Extensions = nil } @@ -571,6 +879,104 @@ func (schema Schema) JSONLookup(token string) (any, error) { return schema.MaxProps, nil case "discriminator": return schema.Discriminator, nil + + // OpenAPI 3.1 / JSON Schema 2020-12 fields + case "const": + return schema.Const, nil + case "examples": + return schema.Examples, nil + case "prefixItems": + return schema.PrefixItems, nil + case "contains": + if schema.Contains != nil { + if schema.Contains.Ref != "" { + return &Ref{Ref: schema.Contains.Ref}, nil + } + return schema.Contains.Value, nil + } + case "minContains": + return schema.MinContains, nil + case "maxContains": + return schema.MaxContains, nil + case "patternProperties": + return schema.PatternProperties, nil + case "dependentSchemas": + return schema.DependentSchemas, nil + case "propertyNames": + if schema.PropertyNames != nil { + if schema.PropertyNames.Ref != "" { + return &Ref{Ref: schema.PropertyNames.Ref}, nil + } + return schema.PropertyNames.Value, nil + } + case "unevaluatedItems": + if ui := schema.UnevaluatedItems.Has; ui != nil { + return *ui, nil + } + if ui := schema.UnevaluatedItems.Schema; ui != nil { + if ui.Ref != "" { + return &Ref{Ref: ui.Ref}, nil + } + return ui.Value, nil + } + case "unevaluatedProperties": + if up := schema.UnevaluatedProperties.Has; up != nil { + return *up, nil + } + if up := schema.UnevaluatedProperties.Schema; up != nil { + if up.Ref != "" { + return &Ref{Ref: up.Ref}, nil + } + return up.Value, nil + } + case "if": + if schema.If != nil { + if schema.If.Ref != "" { + return &Ref{Ref: schema.If.Ref}, nil + } + return schema.If.Value, nil + } + case "then": + if schema.Then != nil { + if schema.Then.Ref != "" { + return &Ref{Ref: schema.Then.Ref}, nil + } + return schema.Then.Value, nil + } + case "else": + if schema.Else != nil { + if schema.Else.Ref != "" { + return &Ref{Ref: schema.Else.Ref}, nil + } + return schema.Else.Value, nil + } + case "dependentRequired": + return schema.DependentRequired, nil + case "$defs": + return schema.Defs, nil + case "$schema": + return schema.SchemaDialect, nil + case "$comment": + return schema.Comment, nil + case "$id": + return schema.SchemaID, nil + case "$anchor": + return schema.Anchor, nil + case "$dynamicRef": + return schema.DynamicRef, nil + case "$dynamicAnchor": + return schema.DynamicAnchor, nil + case "contentMediaType": + return schema.ContentMediaType, nil + case "contentEncoding": + return schema.ContentEncoding, nil + case "contentSchema": + if schema.ContentSchema != nil { + if schema.ContentSchema.Ref != "" { + return &Ref{Ref: schema.ContentSchema.Ref}, nil + } + return schema.ContentSchema.Value, nil + } } v, _, err := jsonpointer.GetForToken(schema.Extensions, token) @@ -700,13 +1106,27 @@ func (schema *Schema) WithMax(value float64) *Schema { return schema } +// WithExclusiveMin sets exclusiveMinimum as a boolean (OpenAPI 3.0 style). func (schema *Schema) WithExclusiveMin(value bool) *Schema { - schema.ExclusiveMin = value + schema.ExclusiveMin = ExclusiveBound{Bool: &value} return schema } +// WithExclusiveMax sets exclusiveMaximum as a boolean (OpenAPI 3.0 style). func (schema *Schema) WithExclusiveMax(value bool) *Schema { - schema.ExclusiveMax = value + schema.ExclusiveMax = ExclusiveBound{Bool: &value} + return schema +} + +// WithExclusiveMinValue sets exclusiveMinimum as a number (OpenAPI 3.1 style). +func (schema *Schema) WithExclusiveMinValue(value float64) *Schema { + schema.ExclusiveMin = ExclusiveBound{Value: &value} + return schema +} + +// WithExclusiveMaxValue sets exclusiveMaximum as a number (OpenAPI 3.1 style). +func (schema *Schema) WithExclusiveMaxValue(value float64) *Schema { + schema.ExclusiveMax = ExclusiveBound{Value: &value} return schema } @@ -800,12 +1220,10 @@ func (schema *Schema) WithProperty(name string, propertySchema *Schema) *Schema } func (schema *Schema) WithPropertyRef(name string, ref *SchemaRef) *Schema { - properties := schema.Properties - if properties == nil { - properties = make(Schemas) - schema.Properties = properties + if schema.Properties == nil { + schema.Properties = make(Schemas) } - properties[name] = ref + schema.Properties[name] = ref return schema } @@ -838,12 +1256,12 @@ func (schema *Schema) WithMaxProperties(i int64) *Schema { } func (schema *Schema) WithAnyAdditionalProperties() *Schema { - schema.AdditionalProperties = AdditionalProperties{Has: Ptr(true)} + schema.AdditionalProperties = AdditionalProperties{Has: new(true)} return schema } func (schema *Schema) WithoutAdditionalProperties() *Schema { - schema.AdditionalProperties = AdditionalProperties{Has: Ptr(false)} + schema.AdditionalProperties = AdditionalProperties{Has: new(false)} return schema } @@ -856,19 +1274,20 @@ func (schema *Schema) WithAdditionalProperties(v *Schema) *Schema { } func (schema *Schema) PermitsNull() bool { - return schema.Nullable || schema.Type.Includes("null") + return schema.Nullable || schema.Type.IncludesNull() } // IsEmpty tells whether schema is equivalent to the empty schema `{}`. func (schema *Schema) IsEmpty() bool { if schema.Type != nil || schema.Format != "" || len(schema.Enum) != 0 || - schema.UniqueItems || schema.ExclusiveMin || schema.ExclusiveMax || + schema.UniqueItems || schema.ExclusiveMin.IsSet() || schema.ExclusiveMax.IsSet() || schema.Nullable || schema.ReadOnly || schema.WriteOnly || schema.AllowEmptyValue || schema.Min != nil || schema.Max != nil || schema.MultipleOf != nil || schema.MinLength != 0 || schema.MaxLength != nil || schema.Pattern != "" || schema.MinItems != 0 || schema.MaxItems != nil || len(schema.Required) != 0 || - schema.MinProps != 0 || schema.MaxProps != nil { + schema.MinProps != 0 || schema.MaxProps != nil || + schema.Const != nil { return false } if n := schema.Not; n != nil && n.Value != nil && !n.Value.IsEmpty() { @@ -883,11 +1302,50 @@ func (schema *Schema) IsEmpty() bool { if items := schema.Items; items != nil && items.Value != nil && !items.Value.IsEmpty() { return false } + for _, s := range schema.PrefixItems { + if ss := s.Value; ss != nil && !ss.IsEmpty() { + return false + } + } + if c := schema.Contains; c != nil && c.Value != nil && !c.Value.IsEmpty() { + return false + } + if schema.MinContains != nil || schema.MaxContains != nil { + return false + } for _, s := range schema.Properties { if ss := s.Value; ss != nil && !ss.IsEmpty() { return false } } + for _, s := range schema.PatternProperties { + if ss := s.Value; ss != nil && !ss.IsEmpty() { + return false + } + } + for _, s := range schema.DependentSchemas { + if ss := s.Value; ss != nil && !ss.IsEmpty() { + return false + } + } + if pn := schema.PropertyNames; pn != nil && pn.Value != nil && !pn.Value.IsEmpty() { + return false + } + if ui := schema.UnevaluatedItems.Schema; ui != nil && ui.Value != nil && !ui.Value.IsEmpty() { + return false + } + if uih := schema.UnevaluatedItems.Has; uih != nil && !*uih { + return false + } + if up := schema.UnevaluatedProperties.Schema; up != nil && up.Value != nil && !up.Value.IsEmpty() { + return false + } + if uph := schema.UnevaluatedProperties.Has; uph != nil && !*uph { + return false + } + if len(schema.Examples) != 0 { + return false + } for _, s := range schema.OneOf { if ss := s.Value; ss != nil && !ss.IsEmpty() { return false @@ -903,31 +1361,200 @@ func (schema *Schema) IsEmpty() bool { return false } } + if f := schema.If; f != nil && f.Value != nil && !f.Value.IsEmpty() { + return false + } + if t := schema.Then; t != nil && t.Value != nil && !t.Value.IsEmpty() { + return false + } + if e := schema.Else; e != nil && e.Value != nil && !e.Value.IsEmpty() { + return false + } + if len(schema.DependentRequired) != 0 { + return false + } + if len(schema.Defs) != 0 { + return false + } + if schema.SchemaDialect != "" || schema.Comment != "" { + return false + } + if schema.SchemaID != "" || schema.Anchor != "" || schema.DynamicRef != "" || schema.DynamicAnchor != "" { + return false + } + if schema.ContentMediaType != "" || schema.ContentEncoding != "" { + return false + } + if cs := schema.ContentSchema; cs != nil && cs.Value != nil && !cs.Value.IsEmpty() { + return false + } return true } // Validate returns an error if Schema does not comply with the OpenAPI spec. func (schema *Schema) Validate(ctx context.Context, opts ...ValidationOption) error { + // Apply document-level validation options to the context ctx = WithValidationOptions(ctx, opts...) + + // Perform schema validation with the options in context _, err := schema.validate(ctx, []*Schema{}) return err } // returns the updated stack and an error if Schema does not comply with the OpenAPI spec. func (schema *Schema) validate(ctx context.Context, stack []*Schema) ([]*Schema, error) { + if slices.Contains(stack, schema) { + return stack, nil + } + validationOpts := getValidationOptions(ctx) - for _, existing := range stack { - if existing == schema { - return stack, nil - } - } stack = append(stack, schema) if schema.ReadOnly && schema.WriteOnly { return stack, errors.New("a property MUST NOT be marked as both readOnly and writeOnly being true") } + // Reject fields that only exist in OAS 3.1 / JSON Schema 2020-12 when the + // document is OAS 3.0. Fields explicitly allowed via AllowExtraSiblingFields + // are skipped (opt-in escape hatch for 3.0 docs that reference external + // JSON Schema documents). Once 3.0 moves to its own schema validator this + // block becomes a no-op. + if !validationOpts.isOpenAPI31OrLater { + allowed := validationOpts.extraSiblingFieldsAllowed + reject := func(field string) error { + if _, ok := allowed[field]; ok { + return nil + } + return errFieldFor31Plus(field) + } + if schema.Const != nil { + if err := reject("const"); err != nil { + return stack, err + } + } + if len(schema.Examples) != 0 { + if err := reject("examples"); err != nil { + return stack, err + } + } + if len(schema.PrefixItems) != 0 { + if err := reject("prefixItems"); err != nil { + return stack, err + } + } + if schema.Contains != nil { + if err := reject("contains"); err != nil { + return stack, err + } + } + if schema.MinContains != nil { + if err := reject("minContains"); err != nil { + return stack, err + } + } + if schema.MaxContains != nil { + if err := reject("maxContains"); err != nil { + return stack, err + } + } + if len(schema.PatternProperties) != 0 { + if err := reject("patternProperties"); err != nil { + return stack, err + } + } + if len(schema.DependentSchemas) != 0 { + if err := reject("dependentSchemas"); err != nil { + return stack, err + } + } + if schema.PropertyNames != nil { + if err := reject("propertyNames"); err != nil { + return stack, err + } + } + if schema.UnevaluatedItems.Has != nil || schema.UnevaluatedItems.Schema != nil { + if err := reject("unevaluatedItems"); err != nil { + return stack, err + } + } + if schema.UnevaluatedProperties.Has != nil || schema.UnevaluatedProperties.Schema != nil { + if err := reject("unevaluatedProperties"); err != nil { + return stack, err + } + } + if schema.If != nil { + if err := reject("if"); err != nil { + return stack, err + } + } + if schema.Then != nil { + if err := reject("then"); err != nil { + return stack, err + } + } + if schema.Else != nil { + if err := reject("else"); err != nil { + return stack, err + } + } + if len(schema.DependentRequired) != 0 { + if err := reject("dependentRequired"); err != nil { + return stack, err + } + } + if len(schema.Defs) != 0 { + if err := reject("$defs"); err != nil { + return stack, err + } + } + if schema.SchemaDialect != "" { + if err := reject("$schema"); err != nil { + return stack, err + } + } + if schema.Comment != "" { + if err := reject("$comment"); err != nil { + return stack, err + } + } + if schema.SchemaID != "" { + if err := reject("$id"); err != nil { + return stack, err + } + } + if schema.Anchor != "" { + if err := reject("$anchor"); err != nil { + return stack, err + } + } + if schema.DynamicRef != "" { + if err := reject("$dynamicRef"); err != nil { + return stack, err + } + } + if schema.DynamicAnchor != "" { + if err := reject("$dynamicAnchor"); err != nil { + return stack, err + } + } + if schema.ContentMediaType != "" { + if err := reject("contentMediaType"); err != nil { + return stack, err + } + } + if schema.ContentEncoding != "" { + if err := reject("contentEncoding"); err != nil { + return stack, err + } + } + if schema.ContentSchema != nil { + if err := reject("contentSchema"); err != nil { + return stack, err + } + } + } + for _, item := range schema.OneOf { v := item.Value if v == nil { @@ -976,6 +1603,37 @@ func (schema *Schema) validate(ctx context.Context, stack []*Schema) ([]*Schema, } } + if ref := schema.If; ref != nil { + v := ref.Value + if v == nil { + return stack, foundUnresolvedRef(ref.Ref) + } + var err error + if stack, err = v.validate(ctx, stack); err != nil { + return stack, err + } + } + if ref := schema.Then; ref != nil { + v := ref.Value + if v == nil { + return stack, foundUnresolvedRef(ref.Ref) + } + var err error + if stack, err = v.validate(ctx, stack); err != nil { + return stack, err + } + } + if ref := schema.Else; ref != nil { + v := ref.Value + if v == nil { + return stack, foundUnresolvedRef(ref.Ref) + } + var err error + if stack, err = v.validate(ctx, stack); err != nil { + return stack, err + } + } + for _, schemaType := range schema.Type.Slice() { switch schemaType { case TypeBoolean: @@ -1026,16 +1684,23 @@ func (schema *Schema) validate(ctx context.Context, stack []*Schema) ([]*Schema, } } case TypeArray: - if schema.Items == nil { + if schema.Items == nil && !validationOpts.jsonSchema2020ValidationEnabled && len(schema.PrefixItems) == 0 { return stack, errors.New("when schema type is 'array', schema 'items' must be non-null") } case TypeObject: + case TypeNull: + if !validationOpts.jsonSchema2020ValidationEnabled { + return stack, fmt.Errorf("unsupported 'type' value %q", schemaType) + } default: return stack, fmt.Errorf("unsupported 'type' value %q", schemaType) } } if ref := schema.Items; ref != nil { + if err := ref.validateExtras(ctx); err != nil { + return stack, err + } v := ref.Value if v == nil { return stack, foundUnresolvedRef(ref.Ref) @@ -1047,13 +1712,11 @@ func (schema *Schema) validate(ctx context.Context, stack []*Schema) ([]*Schema, } } - properties := make([]string, 0, len(schema.Properties)) - for name := range schema.Properties { - properties = append(properties, name) - } - sort.Strings(properties) - for _, name := range properties { + for _, name := range componentNames(schema.Properties) { ref := schema.Properties[name] + if err := ref.validateExtras(ctx); err != nil { + return stack, err + } v := ref.Value if v == nil { return stack, foundUnresolvedRef(ref.Ref) @@ -1069,6 +1732,146 @@ func (schema *Schema) validate(ctx context.Context, stack []*Schema) ([]*Schema, return stack, errors.New("additionalProperties are set to both boolean and schema") } if ref := schema.AdditionalProperties.Schema; ref != nil { + if err := ref.validateExtras(ctx); err != nil { + return stack, err + } + v := ref.Value + if v == nil { + return stack, foundUnresolvedRef(ref.Ref) + } + + var err error + if stack, err = v.validate(ctx, stack); err != nil { + return stack, err + } + } + + // OpenAPI 3.1 / JSON Schema 2020-12 sub-schemas + for _, ref := range schema.PrefixItems { + if err := ref.validateExtras(ctx); err != nil { + return stack, err + } + v := ref.Value + if v == nil { + return stack, foundUnresolvedRef(ref.Ref) + } + + var err error + if stack, err = v.validate(ctx, stack); err != nil { + return stack, err + } + } + if ref := schema.Contains; ref != nil { + if err := ref.validateExtras(ctx); err != nil { + return stack, err + } + v := ref.Value + if v == nil { + return stack, foundUnresolvedRef(ref.Ref) + } + + var err error + if stack, err = v.validate(ctx, stack); err != nil { + return stack, err + } + } + for _, name := range componentNames(schema.PatternProperties) { + ref := schema.PatternProperties[name] + if err := ref.validateExtras(ctx); err != nil { + return stack, err + } + v := ref.Value + if v == nil { + return stack, foundUnresolvedRef(ref.Ref) + } + + var err error + if stack, err = v.validate(ctx, stack); err != nil { + return stack, err + } + } + for _, name := range componentNames(schema.DependentSchemas) { + ref := schema.DependentSchemas[name] + if err := ref.validateExtras(ctx); err != nil { + return stack, err + } + v := ref.Value + if v == nil { + return stack, foundUnresolvedRef(ref.Ref) + } + + var err error + if stack, err = v.validate(ctx, stack); err != nil { + return stack, err + } + } + for _, name := range componentNames(schema.Defs) { + ref := schema.Defs[name] + if err := ref.validateExtras(ctx); err != nil { + return stack, err + } + v := ref.Value + if v == nil { + return stack, foundUnresolvedRef(ref.Ref) + } + + var err error + if stack, err = v.validate(ctx, stack); err != nil { + return stack, err + } + } + if ref := schema.PropertyNames; ref != nil { + if err := ref.validateExtras(ctx); err != nil { + return stack, err + } + v := ref.Value + if v == nil { + return stack, foundUnresolvedRef(ref.Ref) + } + + var err error + if stack, err = v.validate(ctx, stack); err != nil { + return stack, err + } + } + if schema.UnevaluatedItems.Has != nil && schema.UnevaluatedItems.Schema != nil { + return stack, errors.New("unevaluatedItems is set to both boolean and schema") + } + if ref := schema.UnevaluatedItems.Schema; ref != nil { + if err := ref.validateExtras(ctx); err != nil { + return stack, err + } + v := ref.Value + if v == nil { + return stack, foundUnresolvedRef(ref.Ref) + } + + var err error + if stack, err = v.validate(ctx, stack); err != nil { + return stack, err + } + } + if schema.UnevaluatedProperties.Has != nil && schema.UnevaluatedProperties.Schema != nil { + return stack, errors.New("unevaluatedProperties is set to both boolean and schema") + } + if ref := schema.UnevaluatedProperties.Schema; ref != nil { + if err := ref.validateExtras(ctx); err != nil { + return stack, err + } + v := ref.Value + if v == nil { + return stack, foundUnresolvedRef(ref.Ref) + } + + var err error + if stack, err = v.validate(ctx, stack); err != nil { + return stack, err + } + } + if ref := schema.ContentSchema; ref != nil { + if err := ref.validateExtras(ctx); err != nil { + return stack, err + } v := ref.Value if v == nil { return stack, foundUnresolvedRef(ref.Ref) @@ -1087,7 +1890,7 @@ func (schema *Schema) validate(ctx context.Context, stack []*Schema) ([]*Schema, } if v := schema.Default; v != nil && !validationOpts.schemaDefaultsValidationDisabled { - if err := schema.VisitJSON(v); err != nil { + if err := validateExampleValue(ctx, v, schema); err != nil { return stack, fmt.Errorf("invalid default: %w", err) } } @@ -1131,8 +1934,14 @@ func (schema *Schema) IsMatchingJSONObject(value map[string]any) bool { return schema.visitJSON(settings, value) == nil } +// VisitJSON applies a Schema to the given data, considering opts. +// To validate data against an OpenAPIv3.1+ schema, be sure to pass the EnableJSONSchema2020() option. func (schema *Schema) VisitJSON(value any, opts ...SchemaValidationOption) error { settings := newSchemaValidationSettings(opts...) + + if settings.useJSONSchema2020 { + return schema.useJSONSchema2020(settings, value) + } return schema.visitJSON(settings, value) } @@ -1172,6 +1981,9 @@ func (schema *Schema) visitJSON(settings *schemaValidationSettings, value any) ( if err = schema.visitEnumOperation(settings, value); err != nil { return } + if err = schema.visitConstOperation(settings, value); err != nil { + return + } switch value := value.(type) { case nil: @@ -1266,7 +2078,40 @@ func (schema *Schema) visitEnumOperation(settings *schemaValidationSettings, val Value: value, Schema: schema, SchemaField: "enum", - Reason: fmt.Sprintf("value is not one of the allowed values %s", string(allowedValues)), + Reason: "value is not one of the allowed values " + string(allowedValues), + customizeMessageError: settings.customizeMessageError, + } + } + return +} + +func (schema *Schema) visitConstOperation(settings *schemaValidationSettings, value any) (err error) { + if schema.Const == nil { + return + } + var match bool + switch c := value.(type) { + case json.Number: + var f float64 + if f, err = strconv.ParseFloat(c.String(), 64); err != nil { + return err + } + match = reflect.DeepEqual(schema.Const, f) + case int64: + match = reflect.DeepEqual(schema.Const, float64(c)) + default: + match = reflect.DeepEqual(schema.Const, value) + } + if !match { + if settings.failfast { + return errSchema + } + constVal, _ := json.Marshal(schema.Const) + return &SchemaError{ + Value: value, + Schema: schema, + SchemaField: "const", + Reason: "value must be " + string(constVal), customizeMessageError: settings.customizeMessageError, } } @@ -1296,41 +2141,54 @@ func (schema *Schema) visitNotOperation(settings *schemaValidationSettings, valu // If the XOF operations pass successfully, abort further run of validation, as they will already be satisfied (unless the schema // itself is badly specified +// resolveDiscriminatorRef resolves the discriminator reference for oneOf/anyOf validation. +// Returns the discriminator ref string and any error encountered during resolution. +func (schema *Schema) resolveDiscriminatorRef(value any) (string, error) { + if schema.Discriminator == nil { + return "", nil + } + pn := schema.Discriminator.PropertyName + valuemap, okcheck := value.(map[string]any) + if !okcheck { + return "", nil + } + discriminatorVal, okcheck := valuemap[pn] + if !okcheck { + return "", &SchemaError{ + Schema: schema, + SchemaField: "discriminator", + Reason: fmt.Sprintf("input does not contain the discriminator property %q", pn), + } + } + + discriminatorValString, okcheck := discriminatorVal.(string) + if !okcheck { + return "", &SchemaError{ + Value: discriminatorVal, + Schema: schema, + SchemaField: "discriminator", + Reason: fmt.Sprintf("value of discriminator property %q is not a string", pn), + } + } + + if discriminatorRef, okcheck := schema.Discriminator.Mapping[discriminatorValString]; len(schema.Discriminator.Mapping) > 0 && !okcheck { + return "", &SchemaError{ + Value: discriminatorVal, + Schema: schema, + SchemaField: "discriminator", + Reason: fmt.Sprintf("discriminator property %q has invalid value", pn), + } + } else { + return discriminatorRef.Ref, nil + } +} + func (schema *Schema) visitXOFOperations(settings *schemaValidationSettings, value any) (err error, run bool) { var visitedOneOf, visitedAnyOf, visitedAllOf bool if v := schema.OneOf; len(v) > 0 { - var discriminatorRef string - if schema.Discriminator != nil { - pn := schema.Discriminator.PropertyName - if valuemap, okcheck := value.(map[string]any); okcheck { - discriminatorVal, okcheck := valuemap[pn] - if !okcheck { - return &SchemaError{ - Schema: schema, - SchemaField: "discriminator", - Reason: fmt.Sprintf("input does not contain the discriminator property %q", pn), - }, false - } - - discriminatorValString, okcheck := discriminatorVal.(string) - if !okcheck { - return &SchemaError{ - Value: discriminatorVal, - Schema: schema, - SchemaField: "discriminator", - Reason: fmt.Sprintf("value of discriminator property %q is not a string", pn), - }, false - } - - if discriminatorRef, okcheck = schema.Discriminator.Mapping[discriminatorValString]; len(schema.Discriminator.Mapping) > 0 && !okcheck { - return &SchemaError{ - Value: discriminatorVal, - Schema: schema, - SchemaField: "discriminator", - Reason: fmt.Sprintf("discriminator property %q has invalid value", pn), - }, false - } - } + discriminatorRef, err := schema.resolveDiscriminatorRef(value) + if err != nil { + return err, false } var ( @@ -1392,6 +2250,11 @@ func (schema *Schema) visitXOFOperations(settings *schemaValidationSettings, val } if v := schema.AnyOf; len(v) > 0 { + discriminatorRef, err := schema.resolveDiscriminatorRef(value) + if err != nil { + return err, false + } + var ( ok = false matchedAnyOfIdx = 0 @@ -1402,6 +2265,11 @@ func (schema *Schema) visitXOFOperations(settings *schemaValidationSettings, val if v == nil { return foundUnresolvedRef(item.Ref), false } + + if discriminatorRef != "" && discriminatorRef != item.Ref { + continue + } + // make a deep copy to protect origin value from being injected default value that defined in mismatched anyOf schema if settings.asreq || settings.asrep { tempValue = deepcopy.Copy(value) @@ -1527,7 +2395,12 @@ func (schema *Schema) visitJSONNumber(settings *schemaValidationSettings, value format := schema.Format if format != "" { if requireInteger { - if f, ok := SchemaIntegerFormats[format]; ok { + // Check per-validation validators first, then fall back to global + f, ok := settings.integerFormats[format] + if !ok { + f, ok = SchemaIntegerFormats[format] + } + if ok { if err := f.Validate(int64(value)); err != nil { var reason string schemaErr := &SchemaError{} @@ -1541,7 +2414,12 @@ func (schema *Schema) visitJSONNumber(settings *schemaValidationSettings, value } } } else { - if f, ok := SchemaNumberFormats[format]; ok { + // Check per-validation validators first, then fall back to global + f, ok := settings.numberFormats[format] + if !ok { + f, ok = SchemaNumberFormats[format] + } + if ok { if err := f.Validate(value); err != nil { var reason string schemaErr := &SchemaError{} @@ -1573,39 +2451,73 @@ func (schema *Schema) visitJSONNumber(settings *schemaValidationSettings, value } // "exclusiveMinimum" - if v := schema.ExclusiveMin; v && !(*schema.Min < value) { - if settings.failfast { - return errSchema - } - err := &SchemaError{ - Value: value, - Schema: schema, - SchemaField: "exclusiveMinimum", - Reason: fmt.Sprintf("number must be more than %g", *schema.Min), - customizeMessageError: settings.customizeMessageError, + // OpenAPI 3.0: boolean modifier for minimum + // OpenAPI 3.1: number representing the actual exclusive bound + if eb := schema.ExclusiveMin; eb.IsSet() { + var exclusiveMinBound float64 + var valid bool + if eb.Value != nil { + // OpenAPI 3.1 style: exclusiveMinimum is the bound itself + exclusiveMinBound = *eb.Value + valid = value > exclusiveMinBound + } else if eb.Bool != nil && *eb.Bool && schema.Min != nil { + // OpenAPI 3.0 style: exclusiveMinimum modifies minimum + exclusiveMinBound = *schema.Min + valid = value > exclusiveMinBound + } else { + valid = true } - if !settings.multiError { - return err + if !valid { + if settings.failfast { + return errSchema + } + err := &SchemaError{ + Value: value, + Schema: schema, + SchemaField: "exclusiveMinimum", + Reason: fmt.Sprintf("number must be more than %g", exclusiveMinBound), + customizeMessageError: settings.customizeMessageError, + } + if !settings.multiError { + return err + } + me = append(me, err) } - me = append(me, err) } // "exclusiveMaximum" - if v := schema.ExclusiveMax; v && !(*schema.Max > value) { - if settings.failfast { - return errSchema - } - err := &SchemaError{ - Value: value, - Schema: schema, - SchemaField: "exclusiveMaximum", - Reason: fmt.Sprintf("number must be less than %g", *schema.Max), - customizeMessageError: settings.customizeMessageError, + // OpenAPI 3.0: boolean modifier for maximum + // OpenAPI 3.1: number representing the actual exclusive bound + if eb := schema.ExclusiveMax; eb.IsSet() { + var exclusiveMaxBound float64 + var valid bool + if eb.Value != nil { + // OpenAPI 3.1 style: exclusiveMaximum is the bound itself + exclusiveMaxBound = *eb.Value + valid = value < exclusiveMaxBound + } else if eb.Bool != nil && *eb.Bool && schema.Max != nil { + // OpenAPI 3.0 style: exclusiveMaximum modifies maximum + exclusiveMaxBound = *schema.Max + valid = value < exclusiveMaxBound + } else { + valid = true } - if !settings.multiError { - return err + if !valid { + if settings.failfast { + return errSchema + } + err := &SchemaError{ + Value: value, + Schema: schema, + SchemaField: "exclusiveMaximum", + Reason: fmt.Sprintf("number must be less than %g", exclusiveMaxBound), + customizeMessageError: settings.customizeMessageError, + } + if !settings.multiError { + return err + } + me = append(me, err) } - me = append(me, err) } // "minimum" @@ -1767,7 +2679,12 @@ func (schema *Schema) visitJSONString(settings *schemaValidationSettings, value var formatStrErr string var formatErr error if format := schema.Format; format != "" { - if f, ok := SchemaStringFormats[format]; ok { + // Check per-validation validators first, then fall back to global + f, ok := settings.stringFormats[format] + if !ok { + f, ok = SchemaStringFormats[format] + } + if ok { if err := f.Validate(value); err != nil { var reason string schemaErr := &SchemaError{} @@ -1916,12 +2833,7 @@ func (schema *Schema) visitJSONObject(settings *schemaValidationSettings, value var me MultiError if settings.asreq || settings.asrep { - properties := make([]string, 0, len(schema.Properties)) - for propName := range schema.Properties { - properties = append(properties, propName) - } - sort.Strings(properties) - for _, propName := range properties { + for _, propName := range componentNames(schema.Properties) { propSchema := schema.Properties[propName] reqRO := settings.asreq && propSchema.Value.ReadOnly && !settings.readOnlyValidationDisabled repWO := settings.asrep && propSchema.Value.WriteOnly && !settings.writeOnlyValidationDisabled @@ -1988,12 +2900,7 @@ func (schema *Schema) visitJSONObject(settings *schemaValidationSettings, value if ref := schema.AdditionalProperties.Schema; ref != nil { additionalProperties = ref.Value } - keys := make([]string, 0, len(value)) - for k := range value { - keys = append(keys, k) - } - sort.Strings(keys) - for _, k := range keys { + for _, k := range componentNames(value) { v := value[k] if properties != nil { propertyRef := properties[k] @@ -2144,6 +3051,9 @@ func markSchemaErrorKey(err error, key string) error { if me, ok := unwrapped.(multiErrorForOneOf); ok { _ = markSchemaErrorKey(MultiError(me), key) } + if me, ok := unwrapped.(multiErrorForAllOf); ok { + _ = markSchemaErrorKey(MultiError(me), key) + } } } return v @@ -2257,6 +3167,6 @@ func unsupportedFormat(format string) error { // UnmarshalJSON sets Schemas to a copy of data. func (schemas *Schemas) UnmarshalJSON(data []byte) (err error) { - *schemas, _, err = unmarshalStringMapP[SchemaRef](data) + *schemas, err = unmarshalStringMapP[SchemaRef](data) return } diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/schema_formats.go b/vendor/github.com/getkin/kin-openapi/openapi3/schema_formats.go index 489105b..5053510 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/schema_formats.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/schema_formats.go @@ -7,18 +7,19 @@ import ( "regexp" ) -type ( - // FormatValidator is an interface for custom format validators. - FormatValidator[T any] interface { - Validate(value T) error - } - // StringFormatValidator is a type alias for FormatValidator[string] - StringFormatValidator = FormatValidator[string] - // NumberFormatValidator is a type alias for FormatValidator[float64] - NumberFormatValidator = FormatValidator[float64] - // IntegerFormatValidator is a type alias for FormatValidator[int64] - IntegerFormatValidator = FormatValidator[int64] -) +// FormatValidator is an interface for custom format validators. +type FormatValidator[T any] interface { + Validate(value T) error +} + +// StringFormatValidator is a type alias for FormatValidator[string] +type StringFormatValidator = FormatValidator[string] + +// NumberFormatValidator is a type alias for FormatValidator[float64] +type NumberFormatValidator = FormatValidator[float64] + +// IntegerFormatValidator is a type alias for FormatValidator[int64] +type IntegerFormatValidator = FormatValidator[int64] var ( // SchemaStringFormats is a map of custom string format validators. @@ -44,7 +45,7 @@ const ( FormatOfStringDate = `^[0-9]{4}-(0[1-9]|10|11|12)-(0[1-9]|[12][0-9]|3[01])$` // FormatOfStringDateTime is a RFC3339 date-time format regexp, for example "2017-07-21T17:32:28Z". - FormatOfStringDateTime = `^[0-9]{4}-(0[1-9]|10|11|12)-(0[1-9]|[12][0-9]|3[01])T([0-1][0-9]|2[0-3]):[0-5][0-9]:([0-5][0-9]|60)(\.[0-9]+)?(Z|(\+|-)[0-9]{2}:[0-9]{2})?$` + FormatOfStringDateTime = `^[0-9]{4}-(0[1-9]|10|11|12)-(0[1-9]|[12][0-9]|3[01])T([0-1][0-9]|2[0-3]):[0-5][0-9]:([0-5][0-9]|60)(\.[0-9]+)?(Z|(\+|-)[0-9]{2}:[0-9]{2})$` ) func init() { diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/schema_jsonschema_validator.go b/vendor/github.com/getkin/kin-openapi/openapi3/schema_jsonschema_validator.go new file mode 100644 index 0000000..fc92a59 --- /dev/null +++ b/vendor/github.com/getkin/kin-openapi/openapi3/schema_jsonschema_validator.go @@ -0,0 +1,208 @@ +package openapi3 + +import ( + "encoding/json" + "errors" + "fmt" + "strings" + + "github.com/santhosh-tekuri/jsonschema/v6" +) + +// jsonSchemaValidator wraps the santhosh-tekuri/jsonschema validator +type jsonSchemaValidator struct { + compiler *jsonschema.Compiler + schema *jsonschema.Schema +} + +// newJSONSchemaValidator creates a new validator using JSON Schema 2020-12 +func newJSONSchemaValidator(schema *Schema) (*jsonSchemaValidator, error) { + // Convert OpenAPI Schema to JSON Schema format + schemaBytes, err := json.Marshal(schema) + if err != nil { + return nil, fmt.Errorf("failed to marshal schema: %w", err) + } + + var schemaMap map[string]any + if err := json.Unmarshal(schemaBytes, &schemaMap); err != nil { + return nil, fmt.Errorf("failed to unmarshal schema: %w", err) + } + + // OpenAPI 3.1 specific transformations + transformOpenAPIToJSONSchema(schemaMap) + + // Create compiler + compiler := jsonschema.NewCompiler() + compiler.DefaultDraft(jsonschema.Draft2020) + + // Add the schema + schemaURL := "https://example.com/schema.json" + if err := compiler.AddResource(schemaURL, schemaMap); err != nil { + return nil, fmt.Errorf("failed to add schema resource: %w", err) + } + + // Compile the schema + compiledSchema, err := compiler.Compile(schemaURL) + if err != nil { + return nil, fmt.Errorf("failed to compile schema: %w", err) + } + + return &jsonSchemaValidator{ + compiler: compiler, + schema: compiledSchema, + }, nil +} + +// transformOpenAPIToJSONSchema converts OpenAPI 3.0/3.1 specific keywords to JSON Schema format +func transformOpenAPIToJSONSchema(schema map[string]any) { + // Handle nullable - in OpenAPI 3.0, nullable is a boolean flag + // In OpenAPI 3.1 / JSON Schema 2020-12, we use type arrays + if nullable, ok := schema["nullable"].(bool); ok && nullable { + if typeVal, ok := schema["type"].(string); ok { + // Convert to type array with null + schema["type"] = []string{typeVal, "null"} + } else if _, hasType := schema["type"]; !hasType { + // nullable: true without type - add "null" to allow null values + schema["type"] = []string{"null"} + } + delete(schema, "nullable") + } + + // Handle exclusiveMinimum/exclusiveMaximum + // In OpenAPI 3.0, these are booleans alongside minimum/maximum + // In JSON Schema 2020-12, they are numeric values + if exclusiveMin, ok := schema["exclusiveMinimum"].(bool); ok { + if exclusiveMin { + if schemaMin, ok := schema["minimum"].(float64); ok { + schema["exclusiveMinimum"] = schemaMin + delete(schema, "minimum") + } else { + delete(schema, "exclusiveMinimum") + } + } else { + // exclusiveMinimum: false means inclusive, which is the JSON Schema default + delete(schema, "exclusiveMinimum") + } + } + if exclusiveMax, ok := schema["exclusiveMaximum"].(bool); ok { + if exclusiveMax { + if schemaMax, ok := schema["maximum"].(float64); ok { + schema["exclusiveMaximum"] = schemaMax + delete(schema, "maximum") + } else { + delete(schema, "exclusiveMaximum") + } + } else { + // exclusiveMaximum: false means inclusive, which is the JSON Schema default + delete(schema, "exclusiveMaximum") + } + } + + // Remove OpenAPI-specific keywords that aren't in JSON Schema + delete(schema, "discriminator") + delete(schema, "xml") + delete(schema, "externalDocs") + delete(schema, "example") // Use "examples" in 2020-12 + + // Recursively transform nested schemas (single schema fields) + for _, key := range []string{ + "additionalProperties", "items", "not", + // OpenAPI 3.1 / JSON Schema 2020-12 fields + "contains", "propertyNames", "unevaluatedItems", "unevaluatedProperties", + "if", "then", "else", "contentSchema", + } { + if val, ok := schema[key]; ok { + if nestedSchema, ok := val.(map[string]any); ok { + transformOpenAPIToJSONSchema(nestedSchema) + } + } + } + + // Transform schema arrays (oneOf, anyOf, allOf, prefixItems) + for _, key := range []string{"oneOf", "anyOf", "allOf", "prefixItems"} { + if val, ok := schema[key].([]any); ok { + for _, item := range val { + if nestedSchema, ok := item.(map[string]any); ok { + transformOpenAPIToJSONSchema(nestedSchema) + } + } + } + } + + // Transform schema maps (properties, patternProperties, dependentSchemas, $defs) + for _, key := range []string{"properties", "patternProperties", "dependentSchemas", "$defs"} { + if props, ok := schema[key].(map[string]any); ok { + for _, propVal := range props { + if propSchema, ok := propVal.(map[string]any); ok { + transformOpenAPIToJSONSchema(propSchema) + } + } + } + } +} + +// validate validates a value against the compiled JSON Schema +func (v *jsonSchemaValidator) validate(value any) error { + if err := v.schema.Validate(value); err != nil { + // Convert jsonschema error to SchemaError + return convertJSONSchemaError(err) + } + return nil +} + +// convertJSONSchemaError converts a jsonschema validation error to OpenAPI SchemaError format +func convertJSONSchemaError(err error) error { + if err, ok := errors.AsType[*jsonschema.ValidationError](err); ok { + return formatValidationError(err, "") + } + return err +} + +// formatValidationError recursively formats validation errors +func formatValidationError(verr *jsonschema.ValidationError, parentPath string) error { + // Build the path from InstanceLocation slice + path := "/" + strings.Join(verr.InstanceLocation, "/") + if parentPath != "" && path != "/" { + path = parentPath + path + } else if path == "/" { + path = parentPath + } + + // Build error message using the Error() method + var msg strings.Builder + if path != "" { + fmt.Fprintf(&msg, `error at "%s": `, path) + } + msg.WriteString(verr.Error()) + + // If there are sub-errors, format them too + if len(verr.Causes) > 0 { + var subErrors MultiError + for _, cause := range verr.Causes { + if subErr := formatValidationError(cause, path); subErr != nil { + subErrors = append(subErrors, subErr) + } + } + if len(subErrors) > 0 { + return &SchemaError{ + Reason: msg.String(), + Origin: fmt.Errorf("validation failed due to: %w", subErrors), + } + } + } + + return &SchemaError{ + Reason: msg.String(), + } +} + +// useJSONSchema2020 validates using the JSON Schema 2020-12 validator +func (schema *Schema) useJSONSchema2020(settings *schemaValidationSettings, value any) error { + validator, err := newJSONSchemaValidator(schema) + if err != nil { + // Fall back to built-in validator if compilation fails + return schema.visitJSON(settings, value) + } + + return validator.validate(value) +} diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/schema_validation_settings.go b/vendor/github.com/getkin/kin-openapi/openapi3/schema_validation_settings.go index e9c1422..205d95d 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/schema_validation_settings.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/schema_validation_settings.go @@ -21,6 +21,7 @@ type schemaValidationSettings struct { patternValidationDisabled bool readOnlyValidationDisabled bool writeOnlyValidationDisabled bool + useJSONSchema2020 bool // Use JSON Schema 2020-12 validator for OpenAPI 3.1 regexCompiler RegexCompilerFunc @@ -28,6 +29,11 @@ type schemaValidationSettings struct { defaultsSet func() customizeMessageError func(err *SchemaError) string + + // Per-validation format validators (checked before global ones) + stringFormats map[string]StringFormatValidator + numberFormats map[string]NumberFormatValidator + integerFormats map[string]IntegerFormatValidator } // FailFast returns schema validation errors quicker. @@ -83,6 +89,76 @@ func SetSchemaRegexCompiler(c RegexCompilerFunc) SchemaValidationOption { return func(s *schemaValidationSettings) { s.regexCompiler = c } } +// WithStringFormatValidators adds per-validation string format validators. +// These validators are checked before global SchemaStringFormats and allow +// different validations for the same format name across different specs. +func WithStringFormatValidators(validators map[string]StringFormatValidator) SchemaValidationOption { + return func(s *schemaValidationSettings) { + s.stringFormats = validators + } +} + +// WithStringFormatValidator adds a single per-validation string format validator. +// This validator is checked before global SchemaStringFormats and allows +// different validations for the same format name across different specs. +func WithStringFormatValidator(name string, validator StringFormatValidator) SchemaValidationOption { + return func(s *schemaValidationSettings) { + if s.stringFormats == nil { + s.stringFormats = make(map[string]StringFormatValidator) + } + s.stringFormats[name] = validator + } +} + +// WithNumberFormatValidators adds per-validation number format validators. +// These validators are checked before global SchemaNumberFormats and allow +// different validations for the same format name across different specs. +func WithNumberFormatValidators(validators map[string]NumberFormatValidator) SchemaValidationOption { + return func(s *schemaValidationSettings) { + s.numberFormats = validators + } +} + +// WithNumberFormatValidator adds a single per-validation number format validator. +// This validator is checked before global SchemaNumberFormats and allows +// different validations for the same format name across different specs. +func WithNumberFormatValidator(name string, validator NumberFormatValidator) SchemaValidationOption { + return func(s *schemaValidationSettings) { + if s.numberFormats == nil { + s.numberFormats = make(map[string]NumberFormatValidator) + } + s.numberFormats[name] = validator + } +} + +// WithIntegerFormatValidators adds per-validation integer format validators. +// These validators are checked before global SchemaIntegerFormats and allow +// different validations for the same format name across different specs. +func WithIntegerFormatValidators(validators map[string]IntegerFormatValidator) SchemaValidationOption { + return func(s *schemaValidationSettings) { + s.integerFormats = validators + } +} + +// WithIntegerFormatValidator adds a single per-validation integer format validator. +// This validator is checked before global SchemaIntegerFormats and allows +// different validations for the same format name across different specs. +func WithIntegerFormatValidator(name string, validator IntegerFormatValidator) SchemaValidationOption { + return func(s *schemaValidationSettings) { + if s.integerFormats == nil { + s.integerFormats = make(map[string]IntegerFormatValidator) + } + s.integerFormats[name] = validator + } +} + +// EnableJSONSchema2020 enables JSON Schema 2020-12 compliant validation. +// This enables support for OpenAPI 3.1 and JSON Schema 2020-12 features. +// When enabled, validation uses the jsonschema library instead of the built-in validator. +func EnableJSONSchema2020() SchemaValidationOption { + return func(s *schemaValidationSettings) { s.useJSONSchema2020 = true } +} + func newSchemaValidationSettings(opts ...SchemaValidationOption) *schemaValidationSettings { settings := &schemaValidationSettings{} for _, opt := range opts { diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/security_requirements.go b/vendor/github.com/getkin/kin-openapi/openapi3/security_requirements.go index 6af80e8..36b6401 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/security_requirements.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/security_requirements.go @@ -45,13 +45,13 @@ func (security SecurityRequirement) Authenticate(provider string, scopes ...stri // Validate returns an error if SecurityRequirement does not comply with the OpenAPI spec. func (security *SecurityRequirement) Validate(ctx context.Context, opts ...ValidationOption) error { - ctx = WithValidationOptions(ctx, opts...) + // ctx = WithValidationOptions(ctx, opts...) return nil } // UnmarshalJSON sets SecurityRequirement to a copy of data. func (security *SecurityRequirement) UnmarshalJSON(data []byte) (err error) { - *security, _, err = unmarshalStringMap[[]string](data) + *security, err = unmarshalStringMap[[]string](data) return } diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/security_scheme.go b/vendor/github.com/getkin/kin-openapi/openapi3/security_scheme.go index 676002a..1fb1662 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/security_scheme.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/security_scheme.go @@ -5,14 +5,17 @@ import ( "encoding/json" "errors" "fmt" + "maps" "net/url" + "slices" ) // SecurityScheme is specified by OpenAPI/Swagger standard version 3. // See https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.0.3.md#security-scheme-object +// and https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.1.0.md#security-scheme-object type SecurityScheme struct { Extensions map[string]any `json:"-" yaml:"-"` - Origin *Origin `json:"__origin__,omitempty" yaml:"__origin__,omitempty"` + Origin *Origin `json:"-" yaml:"-"` Type string `json:"type,omitempty" yaml:"type,omitempty"` Description string `json:"description,omitempty" yaml:"description,omitempty"` @@ -63,9 +66,7 @@ func (ss SecurityScheme) MarshalJSON() ([]byte, error) { // MarshalYAML returns the YAML encoding of SecurityScheme. func (ss SecurityScheme) MarshalYAML() (any, error) { m := make(map[string]any, 8+len(ss.Extensions)) - for k, v := range ss.Extensions { - m[k] = v - } + maps.Copy(m, ss.Extensions) if x := ss.Type; x != "" { m["type"] = x } @@ -101,7 +102,6 @@ func (ss *SecurityScheme) UnmarshalJSON(data []byte) error { return unmarshalError(err) } _ = json.Unmarshal(data, &x.Extensions) - delete(x.Extensions, originKey) delete(x.Extensions, "type") delete(x.Extensions, "description") delete(x.Extensions, "name") @@ -172,6 +172,10 @@ func (ss *SecurityScheme) Validate(ctx context.Context, opts ...ValidationOption if ss.OpenIdConnectUrl == "" { return fmt.Errorf("no OIDC URL found for openIdConnect security scheme %q", ss.Name) } + case "mutualTLS": + if !getValidationOptions(ctx).isOpenAPI31OrLater { + return errValueOfFieldFor31Plus(ss.Type, "type") + } default: return fmt.Errorf("security scheme 'type' can't be %q", ss.Type) } @@ -218,7 +222,7 @@ func (ss *SecurityScheme) Validate(ctx context.Context, opts ...ValidationOption // See https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.0.3.md#oauth-flows-object type OAuthFlows struct { Extensions map[string]any `json:"-" yaml:"-"` - Origin *Origin `json:"__origin__,omitempty" yaml:"__origin__,omitempty"` + Origin *Origin `json:"-" yaml:"-"` Implicit *OAuthFlow `json:"implicit,omitempty" yaml:"implicit,omitempty"` Password *OAuthFlow `json:"password,omitempty" yaml:"password,omitempty"` @@ -247,9 +251,7 @@ func (flows OAuthFlows) MarshalJSON() ([]byte, error) { // MarshalYAML returns the YAML encoding of OAuthFlows. func (flows OAuthFlows) MarshalYAML() (any, error) { m := make(map[string]any, 4+len(flows.Extensions)) - for k, v := range flows.Extensions { - m[k] = v - } + maps.Copy(m, flows.Extensions) if x := flows.Implicit; x != nil { m["implicit"] = x } @@ -273,7 +275,6 @@ func (flows *OAuthFlows) UnmarshalJSON(data []byte) error { return unmarshalError(err) } _ = json.Unmarshal(data, &x.Extensions) - delete(x.Extensions, originKey) delete(x.Extensions, "implicit") delete(x.Extensions, "password") delete(x.Extensions, "clientCredentials") @@ -320,12 +321,12 @@ func (flows *OAuthFlows) Validate(ctx context.Context, opts ...ValidationOption) // See https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.0.3.md#oauth-flow-object type OAuthFlow struct { Extensions map[string]any `json:"-" yaml:"-"` - Origin *Origin `json:"__origin__,omitempty" yaml:"__origin__,omitempty"` + Origin *Origin `json:"-" yaml:"-"` - AuthorizationURL string `json:"authorizationUrl,omitempty" yaml:"authorizationUrl,omitempty"` - TokenURL string `json:"tokenUrl,omitempty" yaml:"tokenUrl,omitempty"` - RefreshURL string `json:"refreshUrl,omitempty" yaml:"refreshUrl,omitempty"` - Scopes StringMap `json:"scopes" yaml:"scopes"` // required + AuthorizationURL string `json:"authorizationUrl,omitempty" yaml:"authorizationUrl,omitempty"` + TokenURL string `json:"tokenUrl,omitempty" yaml:"tokenUrl,omitempty"` + RefreshURL string `json:"refreshUrl,omitempty" yaml:"refreshUrl,omitempty"` + Scopes StringMap[string] `json:"scopes" yaml:"scopes"` // required } // MarshalJSON returns the JSON encoding of OAuthFlow. @@ -340,9 +341,7 @@ func (flow OAuthFlow) MarshalJSON() ([]byte, error) { // MarshalYAML returns the YAML encoding of OAuthFlow. func (flow OAuthFlow) MarshalYAML() (any, error) { m := make(map[string]any, 4+len(flow.Extensions)) - for k, v := range flow.Extensions { - m[k] = v - } + maps.Copy(m, flow.Extensions) if x := flow.AuthorizationURL; x != "" { m["authorizationUrl"] = x } @@ -365,7 +364,6 @@ func (flow *OAuthFlow) UnmarshalJSON(data []byte) error { } _ = json.Unmarshal(data, &x.Extensions) - delete(x.Extensions, originKey) delete(x.Extensions, "authorizationUrl") delete(x.Extensions, "tokenUrl") delete(x.Extensions, "refreshUrl") @@ -398,12 +396,7 @@ func (flow *OAuthFlow) validate(ctx context.Context, typ oAuthFlowType, opts ... ctx = WithValidationOptions(ctx, opts...) typeIn := func(types ...oAuthFlowType) bool { - for _, ty := range types { - if ty == typ { - return true - } - } - return false + return slices.Contains(types, typ) } if in := typeIn(oAuthFlowTypeImplicit, oAuthFlowAuthorizationCode); true { @@ -437,6 +430,6 @@ func (flow *OAuthFlow) validate(ctx context.Context, typ oAuthFlowType, opts ... // UnmarshalJSON sets SecuritySchemes to a copy of data. func (securitySchemes *SecuritySchemes) UnmarshalJSON(data []byte) (err error) { - *securitySchemes, _, err = unmarshalStringMapP[SecuritySchemeRef](data) + *securitySchemes, err = unmarshalStringMapP[SecuritySchemeRef](data) return } diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/server.go b/vendor/github.com/getkin/kin-openapi/openapi3/server.go index ea77517..49f940d 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/server.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/server.go @@ -5,8 +5,8 @@ import ( "encoding/json" "errors" "fmt" + "maps" "net/url" - "sort" "strings" ) @@ -51,11 +51,11 @@ func (servers Servers) MatchURL(parsedURL *url.URL) (*Server, []string, string) // See https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.0.3.md#server-object type Server struct { Extensions map[string]any `json:"-" yaml:"-"` - Origin *Origin `json:"__origin__,omitempty" yaml:"__origin__,omitempty"` + Origin *Origin `json:"-" yaml:"-"` - URL string `json:"url" yaml:"url"` // Required - Description string `json:"description,omitempty" yaml:"description,omitempty"` - Variables map[string]*ServerVariable `json:"variables,omitempty" yaml:"variables,omitempty"` + URL string `json:"url" yaml:"url"` // Required + Description string `json:"description,omitempty" yaml:"description,omitempty"` + Variables ServerVariables `json:"variables,omitempty" yaml:"variables,omitempty"` } // BasePath returns the base path extracted from the default values of variables, if any. @@ -66,8 +66,8 @@ func (server *Server) BasePath() (string, error) { } uri := server.URL - for name, svar := range server.Variables { - uri = strings.ReplaceAll(uri, "{"+name+"}", svar.Default) + for _, name := range componentNames(server.Variables) { + uri = strings.ReplaceAll(uri, "{"+name+"}", server.Variables[name].Default) } u, err := url.ParseRequestURI(uri) @@ -94,9 +94,7 @@ func (server Server) MarshalJSON() ([]byte, error) { // MarshalYAML returns the YAML encoding of Server. func (server Server) MarshalYAML() (any, error) { m := make(map[string]any, 3+len(server.Extensions)) - for k, v := range server.Extensions { - m[k] = v - } + maps.Copy(m, server.Extensions) m["url"] = server.URL if x := server.Description; x != "" { m["description"] = x @@ -115,13 +113,13 @@ func (server *Server) UnmarshalJSON(data []byte) error { return unmarshalError(err) } _ = json.Unmarshal(data, &x.Extensions) - delete(x.Extensions, originKey) delete(x.Extensions, "url") delete(x.Extensions, "description") delete(x.Extensions, "variables") if len(x.Extensions) == 0 { x.Extensions = nil } + delete(x.Variables, originKey) *server = Server(x) return nil } @@ -214,12 +212,7 @@ func (server *Server) Validate(ctx context.Context, opts ...ValidationOption) (e return errors.New("server has undeclared variables") } - variables := make([]string, 0, len(server.Variables)) - for name := range server.Variables { - variables = append(variables, name) - } - sort.Strings(variables) - for _, name := range variables { + for _, name := range componentNames(server.Variables) { v := server.Variables[name] if !strings.Contains(server.URL, "{"+name+"}") { return errors.New("server has undeclared variables") @@ -234,9 +227,18 @@ func (server *Server) Validate(ctx context.Context, opts ...ValidationOption) (e // ServerVariable is specified by OpenAPI/Swagger standard version 3. // See https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.0.3.md#server-variable-object +// ServerVariables is a map of ServerVariable objects keyed by variable name. +type ServerVariables map[string]*ServerVariable + +// UnmarshalJSON sets ServerVariables to a copy of data. +func (serverVariables *ServerVariables) UnmarshalJSON(data []byte) (err error) { + *serverVariables, err = unmarshalStringMapP[ServerVariable](data) + return +} + type ServerVariable struct { Extensions map[string]any `json:"-" yaml:"-"` - Origin *Origin `json:"__origin__,omitempty" yaml:"__origin__,omitempty"` + Origin *Origin `json:"-" yaml:"-"` Enum []string `json:"enum,omitempty" yaml:"enum,omitempty"` Default string `json:"default,omitempty" yaml:"default,omitempty"` @@ -255,9 +257,7 @@ func (serverVariable ServerVariable) MarshalJSON() ([]byte, error) { // MarshalYAML returns the YAML encoding of ServerVariable. func (serverVariable ServerVariable) MarshalYAML() (any, error) { m := make(map[string]any, 4+len(serverVariable.Extensions)) - for k, v := range serverVariable.Extensions { - m[k] = v - } + maps.Copy(m, serverVariable.Extensions) if x := serverVariable.Enum; len(x) != 0 { m["enum"] = x } @@ -278,7 +278,6 @@ func (serverVariable *ServerVariable) UnmarshalJSON(data []byte) error { return unmarshalError(err) } _ = json.Unmarshal(data, &x.Extensions) - delete(x.Extensions, originKey) delete(x.Extensions, "enum") delete(x.Extensions, "default") delete(x.Extensions, "description") diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/stringmap.go b/vendor/github.com/getkin/kin-openapi/openapi3/stringmap.go index d1b91ac..f416899 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/stringmap.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/stringmap.go @@ -3,60 +3,50 @@ package openapi3 import "encoding/json" // StringMap is a map[string]string that ignores the origin in the underlying json representation. -type StringMap map[string]string +type StringMap[V any] map[string]V // UnmarshalJSON sets StringMap to a copy of data. -func (stringMap *StringMap) UnmarshalJSON(data []byte) (err error) { - *stringMap, _, err = unmarshalStringMap[string](data) +func (stringMap *StringMap[V]) UnmarshalJSON(data []byte) (err error) { + *stringMap, err = unmarshalStringMap[V](data) return } // unmarshalStringMapP unmarshals given json into a map[string]*V -func unmarshalStringMapP[V any](data []byte) (map[string]*V, *Origin, error) { +func unmarshalStringMapP[V any](data []byte) (map[string]*V, error) { var m map[string]any if err := json.Unmarshal(data, &m); err != nil { - return nil, nil, err - } - - origin, err := popOrigin(m, originKey) - if err != nil { - return nil, nil, err + return nil, err } result := make(map[string]*V, len(m)) - for k, v := range m { - value, err := deepCast[V](v) + for _, k := range componentNames(m) { + value, err := deepCast[V](m[k]) if err != nil { - return nil, nil, err + return nil, err } result[k] = value } - return result, origin, nil + return result, nil } // unmarshalStringMap unmarshals given json into a map[string]V -func unmarshalStringMap[V any](data []byte) (map[string]V, *Origin, error) { +func unmarshalStringMap[V any](data []byte) (map[string]V, error) { var m map[string]any if err := json.Unmarshal(data, &m); err != nil { - return nil, nil, err - } - - origin, err := popOrigin(m, originKey) - if err != nil { - return nil, nil, err + return nil, err } result := make(map[string]V, len(m)) - for k, v := range m { - value, err := deepCast[V](v) + for _, k := range componentNames(m) { + value, err := deepCast[V](m[k]) if err != nil { - return nil, nil, err + return nil, err } result[k] = *value } - return result, origin, nil + return result, nil } // deepCast casts any value to a value of type V. @@ -72,17 +62,3 @@ func deepCast[V any](value any) (*V, error) { } return &result, nil } - -// popOrigin removes the origin from the map and returns it. -func popOrigin(m map[string]any, key string) (*Origin, error) { - if !IncludeOrigin { - return nil, nil - } - - origin, err := deepCast[Origin](m[key]) - if err != nil { - return nil, err - } - delete(m, key) - return origin, nil -} diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/tag.go b/vendor/github.com/getkin/kin-openapi/openapi3/tag.go index 841161e..2b154c2 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/tag.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/tag.go @@ -4,6 +4,7 @@ import ( "context" "encoding/json" "fmt" + "maps" ) // Tags is specified by OpenAPI/Swagger 3.0 standard. @@ -34,7 +35,7 @@ func (tags Tags) Validate(ctx context.Context, opts ...ValidationOption) error { // See https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.0.3.md#tag-object type Tag struct { Extensions map[string]any `json:"-" yaml:"-"` - Origin *Origin `json:"__origin__,omitempty" yaml:"__origin__,omitempty"` + Origin *Origin `json:"-" yaml:"-"` Name string `json:"name,omitempty" yaml:"name,omitempty"` Description string `json:"description,omitempty" yaml:"description,omitempty"` @@ -53,9 +54,7 @@ func (t Tag) MarshalJSON() ([]byte, error) { // MarshalYAML returns the YAML encoding of Tag. func (t Tag) MarshalYAML() (any, error) { m := make(map[string]any, 3+len(t.Extensions)) - for k, v := range t.Extensions { - m[k] = v - } + maps.Copy(m, t.Extensions) if x := t.Name; x != "" { m["name"] = x } @@ -76,7 +75,6 @@ func (t *Tag) UnmarshalJSON(data []byte) error { return unmarshalError(err) } _ = json.Unmarshal(data, &x.Extensions) - delete(x.Extensions, originKey) delete(x.Extensions, "name") delete(x.Extensions, "description") delete(x.Extensions, "externalDocs") diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/validation_options.go b/vendor/github.com/getkin/kin-openapi/openapi3/validation_options.go index 1d141d4..0da1cc1 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/validation_options.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/validation_options.go @@ -13,6 +13,8 @@ type ValidationOptions struct { schemaFormatValidationEnabled bool schemaPatternValidationDisabled bool schemaExtensionsInRefProhibited bool + jsonSchema2020ValidationEnabled bool + isOpenAPI31OrLater bool regexCompilerFunc RegexCompilerFunc extraSiblingFieldsAllowed map[string]struct{} } @@ -31,6 +33,14 @@ func AllowExtraSiblingFields(fields ...string) ValidationOption { } } +// IsOpenAPI31OrLater enables "JSON Schema Draft 2020-12"-compliant validation (for OpenAPI 3.1 documents). +func IsOpenAPI31OrLater() ValidationOption { + return func(options *ValidationOptions) { + options.isOpenAPI31OrLater = true // To distinguish from v3.0 + options.jsonSchema2020ValidationEnabled = true // TODO: use even for v3.0 + } +} + // EnableSchemaFormatValidation makes Validate not return an error when validating documents that mention schema formats that are not defined by the OpenAPIv3 specification. // By default, schema format validation is disabled. func EnableSchemaFormatValidation() ValidationOption { diff --git a/vendor/github.com/getkin/kin-openapi/openapi3/xml.go b/vendor/github.com/getkin/kin-openapi/openapi3/xml.go index e960249..a1481f2 100644 --- a/vendor/github.com/getkin/kin-openapi/openapi3/xml.go +++ b/vendor/github.com/getkin/kin-openapi/openapi3/xml.go @@ -3,13 +3,14 @@ package openapi3 import ( "context" "encoding/json" + "maps" ) // XML is specified by OpenAPI/Swagger standard version 3. // See https://github.com/OAI/OpenAPI-Specification/blob/main/versions/3.0.3.md#xml-object type XML struct { Extensions map[string]any `json:"-" yaml:"-"` - Origin *Origin `json:"__origin__,omitempty" yaml:"__origin__,omitempty"` + Origin *Origin `json:"-" yaml:"-"` Name string `json:"name,omitempty" yaml:"name,omitempty"` Namespace string `json:"namespace,omitempty" yaml:"namespace,omitempty"` @@ -30,9 +31,7 @@ func (xml XML) MarshalJSON() ([]byte, error) { // MarshalYAML returns the YAML encoding of XML. func (xml XML) MarshalYAML() (any, error) { m := make(map[string]any, 5+len(xml.Extensions)) - for k, v := range xml.Extensions { - m[k] = v - } + maps.Copy(m, xml.Extensions) if x := xml.Name; x != "" { m["name"] = x } @@ -59,7 +58,6 @@ func (xml *XML) UnmarshalJSON(data []byte) error { return unmarshalError(err) } _ = json.Unmarshal(data, &x.Extensions) - delete(x.Extensions, originKey) delete(x.Extensions, "name") delete(x.Extensions, "namespace") delete(x.Extensions, "prefix") diff --git a/vendor/github.com/oasdiff/yaml/README.md b/vendor/github.com/oasdiff/yaml/README.md index bdb0187..4507d74 100644 --- a/vendor/github.com/oasdiff/yaml/README.md +++ b/vendor/github.com/oasdiff/yaml/README.md @@ -6,9 +6,19 @@ ![Latest Tag](https://img.shields.io/github/v/tag/invopop/yaml) ## Fork -This fork is an improved version of the invopop/yaml package, designed to include line and column location information for YAML elements during unmarshalling. -To include location information use ```UnmarshalWithOrigin``` instead of ```Unmarshal```. -The heavy lifting is done by the underlying [oasdiff/yaml3](https://github.com/oasdiff/yaml3) package. +This fork is an improved version of the invopop/yaml package, designed to include line and column location information for YAML elements during unmarshalling. + +Origin tracking uses a two-pass approach: +1. `UnmarshalWithOriginTree` decodes the YAML and extracts `__origin__` metadata injected by the underlying [oasdiff/yaml3](https://github.com/oasdiff/yaml3) decoder, returning an `*OriginTree` alongside the decoded struct. +2. The caller walks the `OriginTree` to apply file/line/column information to the decoded Go structs. + +To decode without origin tracking, use `Unmarshal` as usual. To decode with origin tracking: + +```go +tree, err := yaml.UnmarshalWithOriginTree(data, &v, yaml.OriginOpt{Enabled: true, File: "myfile.yaml"}) +``` + +The returned `*OriginTree` mirrors the YAML document structure. Each node holds a compact `[]any` sequence with the file, key name, line, column, and locations of scalar fields and sequence items within that mapping. When `Enabled` is false, `nil` is returned for the tree with no overhead. ## Introduction diff --git a/vendor/github.com/oasdiff/yaml/yaml.go b/vendor/github.com/oasdiff/yaml/yaml.go index c49678e..d71ee20 100644 --- a/vendor/github.com/oasdiff/yaml/yaml.go +++ b/vendor/github.com/oasdiff/yaml/yaml.go @@ -16,7 +16,7 @@ import ( "reflect" "strconv" - "github.com/oasdiff/yaml3" + yaml "github.com/oasdiff/yaml3" ) // Marshal the object into JSON then converts JSON to YAML and returns the @@ -38,36 +38,159 @@ func Marshal(o interface{}) ([]byte, error) { // JSONOpt is a decoding option for decoding from JSON format. type JSONOpt func(*json.Decoder) *json.Decoder -// YAMLOpt is a decoding option for decoding from YAML format. -type YAMLOpt func(*yaml.Decoder) *yaml.Decoder - // Unmarshal converts YAML to JSON then uses JSON to unmarshal into an object, // optionally configuring the behavior of the JSON unmarshal. func Unmarshal(y []byte, o interface{}, opts ...JSONOpt) error { - return UnmarshalWithOrigin(y, o, false, opts...) + _, err := UnmarshalWithOriginTree(y, o, OriginOpt{}, opts...) + return err } -// UnmarshalWithOrigin is like Unmarshal but if withOrigin is true, it will -// include the origin information in the output. -func UnmarshalWithOrigin(y []byte, o interface{}, withOrigin bool, opts ...JSONOpt) error { - dec := yaml.NewDecoder(bytes.NewReader(y)) - dec.Origin(withOrigin) - return unmarshal(dec, o, opts) +// OriginOpt controls origin-tracking behavior in UnmarshalWithOriginTree. +type OriginOpt struct { + // Enabled adds __origin__ metadata to maps during unmarshaling. + Enabled bool + // File is the source file name recorded in origin metadata. + File string } -func unmarshal(dec *yaml.Decoder, o interface{}, opts []JSONOpt) error { +// OriginTree holds __origin__ data extracted from a YAML-decoded map tree. +// It mirrors the structure of the spec: Fields tracks map children by key, +// Items tracks slice children by index. +type OriginTree struct { + // File is the source file for all origins in this subtree. + // Set once at the root of each decode call; all nodes in the same + // decode share the same file. + File string + // Origin is the raw __origin__ value ([]any compact sequence) for this node. + // Format: [key_name, key_line, key_col, nf, f1_name, f1_delta, f1_col, ..., ns, ...] + Origin any + // Fields holds child trees keyed by map key name. + Fields map[string]*OriginTree + // Items holds child trees for slice elements (index-aligned). + Items []*OriginTree +} + +// UnmarshalWithOriginTree is like UnmarshalWithOrigin but strips __origin__ +// from the intermediate map before JSON conversion and returns the extracted +// origin data as an OriginTree. The caller can apply the tree to Go structs +// after unmarshaling. When origin tracking is disabled, the returned tree is nil. +func UnmarshalWithOriginTree(y []byte, o interface{}, origin OriginOpt, opts ...JSONOpt) (*OriginTree, error) { + dec := yaml.NewDecoder(bytes.NewReader(y)) + dec.Origin(origin.Enabled, origin.File) + + // Decode YAML into a generic object. + var yamlObj interface{} + if err := dec.Decode(&yamlObj); err != nil { + if !errors.Is(err, io.EOF) { + return nil, fmt.Errorf("error converting YAML to JSON: %v", err) + } + } + + // Extract __origin__ before JSON conversion so the JSON stays small. + var tree *OriginTree + if origin.Enabled { + tree = extractOrigins(yamlObj, origin.File) + } + + // Convert to JSON (without __origin__) and unmarshal into the target struct. vo := reflect.ValueOf(o) - j, err := yamlToJSON(dec, &vo) + jsonObj, err := convertToJSONableObject(yamlObj, &vo) if err != nil { - return fmt.Errorf("error converting YAML to JSON: %v", err) + return nil, fmt.Errorf("error converting YAML to JSON: %v", err) } - - err = jsonUnmarshal(bytes.NewReader(j), o, opts...) + j, err := json.Marshal(jsonObj) if err != nil { - return fmt.Errorf("error unmarshaling JSON: %v", err) + return nil, fmt.Errorf("error converting YAML to JSON: %v", err) + } + if err := jsonUnmarshal(bytes.NewReader(j), o, opts...); err != nil { + return nil, fmt.Errorf("error unmarshaling JSON: %v", err) } - return nil + return tree, nil +} + +const originKey = "__origin__" + +// extractOrigins recursively extracts and removes __origin__ entries from a +// YAML-decoded map tree, returning the origin data as an OriginTree. +// file is the source file for all nodes in this decode call. +func extractOrigins(v any, file string) *OriginTree { + switch val := v.(type) { + case map[string]any: + return extractOriginsFromStringMap(val, file) + case map[interface{}]interface{}: + // yaml3 produces map[interface{}]interface{} when map keys are non-string + // (e.g. integer HTTP status codes like 200). __origin__ is always a string + // key, so we must handle this case to strip it from mixed-key maps. + tree := &OriginTree{File: file} + if orig, ok := val[originKey]; ok { + tree.Origin = orig + delete(val, originKey) + } + for k, child := range val { + if childTree := extractOrigins(child, file); childTree != nil { + if tree.Fields == nil { + tree.Fields = make(map[string]*OriginTree) + } + // Convert key to string: mirrors convertToJSONableObject behaviour. + // String keys pass through; int/int64/float64 keys are formatted. + var ks string + switch kt := k.(type) { + case string: + ks = kt + case int: + ks = strconv.Itoa(kt) + case int64: + ks = strconv.FormatInt(kt, 10) + case float64: + ks = strconv.FormatFloat(kt, 'g', -1, 64) + default: + ks = fmt.Sprintf("%v", k) + } + tree.Fields[ks] = childTree + } + } + if tree.Origin == nil && tree.Fields == nil { + return nil + } + return tree + case []any: + var items []*OriginTree + hasChild := false + for _, child := range val { + childTree := extractOrigins(child, file) + items = append(items, childTree) // may be nil; preserves index alignment + if childTree != nil { + hasChild = true + } + } + if !hasChild { + return nil + } + return &OriginTree{File: file, Items: items} + default: + return nil + } +} + +func extractOriginsFromStringMap(val map[string]any, file string) *OriginTree { + tree := &OriginTree{File: file} + if orig, ok := val[originKey]; ok { + tree.Origin = orig + delete(val, originKey) + } + for k, child := range val { + if childTree := extractOrigins(child, file); childTree != nil { + if tree.Fields == nil { + tree.Fields = make(map[string]*OriginTree) + } + tree.Fields[k] = childTree + } + } + if tree.Origin == nil && tree.Fields == nil { + return nil + } + return tree } // jsonUnmarshal unmarshals the JSON byte stream from the given reader into the @@ -142,6 +265,7 @@ func yamlToJSON(dec *yaml.Decoder, jsonTarget *reflect.Value) ([]byte, error) { return json.Marshal(jsonObj) } +// convertToJSONableObject converts a YAML object to a JSON-compatible object. func convertToJSONableObject(yamlObj interface{}, jsonTarget *reflect.Value) (interface{}, error) { //nolint:gocyclo var err error diff --git a/vendor/github.com/oasdiff/yaml3/README.md b/vendor/github.com/oasdiff/yaml3/README.md index f08ebf4..3a218f2 100644 --- a/vendor/github.com/oasdiff/yaml3/README.md +++ b/vendor/github.com/oasdiff/yaml3/README.md @@ -2,7 +2,24 @@ Fork ---- -This fork is an improved version of the go-yaml/yaml package, designed to include line and column location information for YAML elements during unmarshalling. +This fork is an improved version of the go-yaml/yaml package, enhanced to inject `__origin__` metadata into YAML mapping nodes during decoding, recording the file, line, and column of each key. + +To enable origin tracking, call `Origin` on the decoder before decoding: + +```go +dec := yaml.NewDecoder(r) +dec.Origin(true, "myfile.yaml") + +var v interface{} +dec.Decode(&v) +// Each decoded map now contains a synthetic "__origin__" key whose value is +// a compact []interface{} sequence: +// [file, key_name, key_line, key_col, nf, f1_name, f1_delta, f1_col, ..., ns, s1_name, s1_count, (name, delta, col)×count, ...] +// where nf = number of scalar/sequence fields, ns = number of sequences with item locations, +// and deltas are line offsets from key_line. +``` + +Origin nodes are synthetic: their key node has `Line == 0` (since real YAML lines are 1-based), which allows callers to detect and strip them. The [oasdiff/yaml](https://github.com/oasdiff/yaml) package uses this to build an `OriginTree` before JSON conversion, keeping `__origin__` entirely out of the decoded struct. Introduction ------------ @@ -30,33 +47,19 @@ Specifically, as of v3 of the yaml package: - Does not support base-60 floats. These are gone from YAML 1.2, and were actually never supported by this package as it's clearly a poor choice. -and offers backwards -compatibility with YAML 1.1 in some cases. -1.2, including support for -anchors, tags, map merging, etc. Multi-document unmarshalling is not yet -implemented, and base-60 floats from YAML 1.1 are purposefully not -supported since they're a poor design and are gone in YAML 1.2. - Installation and usage ---------------------- -The import path for the package is *gopkg.in/yaml.v3*. +The import path for the package is *github.com/oasdiff/yaml3*. To install it, run: - go get gopkg.in/yaml.v3 + go get github.com/oasdiff/yaml3 API documentation ----------------- -If opened in a browser, the import path itself leads to the API documentation: - - - [https://gopkg.in/yaml.v3](https://gopkg.in/yaml.v3) - -API stability -------------- - -The package API for yaml v3 will remain stable as described in [gopkg.in](https://gopkg.in). + - [https://pkg.go.dev/github.com/oasdiff/yaml3](https://pkg.go.dev/github.com/oasdiff/yaml3) License @@ -76,7 +79,7 @@ import ( "fmt" "log" - "oasdiff/yaml" + "github.com/oasdiff/yaml3" ) var data = ` diff --git a/vendor/github.com/oasdiff/yaml3/decode.go b/vendor/github.com/oasdiff/yaml3/decode.go index 0f2b9f9..293ddda 100644 --- a/vendor/github.com/oasdiff/yaml3/decode.go +++ b/vendor/github.com/oasdiff/yaml3/decode.go @@ -320,6 +320,7 @@ type decoder struct { knownFields bool origin bool + file string uniqueKeys bool decodeCount int aliasCount int @@ -525,6 +526,24 @@ func (d *decoder) unmarshal(n *Node, out reflect.Value) (good bool) { func (d *decoder) document(n *Node, out reflect.Value) (good bool) { if len(n.Content) == 1 { d.doc = n + if d.origin && d.aliasDepth == 0 { + root := n.Content[0] + if root.Kind == MappingNode && len(root.Content) >= 2 { + // Inject __origin__ into the root mapping of the document so that + // $ref-rooted YAML files (e.g. schemas/pet.yaml) expose origin + // metadata on their top-level schema, just like nested mappings do. + // Use the first key's position as the anchor for line-delta calculations. + firstKey := root.Content[0] + syntheticKey := &Node{ + Kind: ScalarNode, + Tag: "!!str", + Value: "", + Line: firstKey.Line, + Column: firstKey.Column, + } + addOriginInMap(syntheticKey, root, d.file) + } + } d.unmarshal(n.Content[0], out) return true } @@ -751,8 +770,8 @@ func (d *decoder) sequence(n *Node, out reflect.Value) (good bool) { j := 0 for i := 0; i < l; i++ { e := reflect.New(et).Elem() - if d.origin { - addOriginInSeq(n.Content[i]) + if d.origin && d.aliasDepth == 0 { + addOriginInSeq(n.Content[i], d.file) } if ok := d.unmarshal(n.Content[i], e); ok { out.Index(j).Set(e) @@ -832,6 +851,24 @@ func (d *decoder) mapping(n *Node, out reflect.Value) (good bool) { mergeNode = n.Content[i+1] continue } + // __origin__ metadata entries are injected when the anchor is first processed. + // Decoding them through the normal path would count toward aliasCount and + // could spuriously trigger the excessive-aliasing check on large specs. + // Decode them with aliasDepth temporarily zeroed so they don't count + // toward aliasCount, but the origin data is still present in the output. + if d.aliasDepth > 0 && isOrigin(n.Content[i]) { + savedAliasDepth := d.aliasDepth + d.aliasDepth = 0 + k := reflect.New(kt).Elem() + if d.unmarshal(n.Content[i], k) { + e := reflect.New(et).Elem() + if d.unmarshal(n.Content[i+1], e) { + out.SetMapIndex(k, e) + } + } + d.aliasDepth = savedAliasDepth + continue + } k := reflect.New(kt).Elem() if d.unmarshal(n.Content[i], k) { if mergedFields != nil { @@ -850,8 +887,8 @@ func (d *decoder) mapping(n *Node, out reflect.Value) (good bool) { } e := reflect.New(et).Elem() - if d.origin { - addOriginInMap(n.Content[i], n.Content[i+1]) + if d.origin && d.aliasDepth == 0 { + addOriginInMap(n.Content[i], n.Content[i+1], d.file) } if d.unmarshal(n.Content[i+1], e) || n.Content[i+1].ShortTag() == nullTag && (mapIsNew || !out.MapIndex(k).IsValid()) { out.SetMapIndex(k, e) diff --git a/vendor/github.com/oasdiff/yaml3/origin.go b/vendor/github.com/oasdiff/yaml3/origin.go index b8ffa2c..3f2f0a7 100644 --- a/vendor/github.com/oasdiff/yaml3/origin.go +++ b/vendor/github.com/oasdiff/yaml3/origin.go @@ -8,122 +8,119 @@ func isScalar(n *Node) bool { return n.Kind == ScalarNode } -func addOriginInSeq(n *Node) *Node { +func isSequence(n *Node) bool { + return n.Kind == SequenceNode +} + +func isMapping(n *Node) bool { + return n.Kind == MappingNode +} - if n.Kind != MappingNode { +func addOriginInSeq(n *Node, file string) *Node { + if !isMapping(n) || len(n.Content) == 0 { return n } - // in case of a sequence, we use the first element as the key - return addOrigin(n.Content[0], n) + return addOrigin(n.Content[0], n, file) } -func addOriginInMap(key, n *Node) *Node { - - if n.Kind != MappingNode { +func addOriginInMap(key, n *Node, file string) *Node { + if !isMapping(n) { return n } - - return addOrigin(key, n) + return addOrigin(key, n, file) } -func addOrigin(key, n *Node) *Node { +// addOrigin injects a compact __origin__ sequence into the mapping node n. +// +// Format: [file, key_name, key_line, key_col, nf, f1_name, f1_delta, f1_col, ..., ns, s1_name, s1_count, s1_l0_delta, s1_c0, ...] +// +// - file: source file path +// - key_name: the YAML key whose value is this mapping +// - key_line, key_col: location of that key +// - nf: number of scalar+sequence fields recorded +// - per field: name (string), line delta from key_line (int), column (int) +// - ns: number of sequence fields that have item locations +// - per sequence: name (string), item count (int), then count × (line delta, col) +func addOrigin(key, n *Node, file string) *Node { if isOrigin(key) { return n } - n.Content = append(n.Content, getNamedMap(originTag, append(getKeyLocation(key), getNamedMap("fields", getFieldLocations(n))...))...) + seq := buildOriginSeq(key, n, file) + n.Content = append(n.Content, + &Node{Kind: ScalarNode, Tag: "!!str", Value: originTag}, // Line==0 → isOrigin + &Node{Kind: SequenceNode, Tag: "!!seq", Content: seq}, + ) return n } -func getFieldLocations(n *Node) []*Node { +func buildOriginSeq(key, n *Node, file string) []*Node { + // Header: file, key_name, key_line, key_col + nodes := []*Node{ + strNode(file), + strNode(key.Value), + intNode(key.Line), + intNode(key.Column), + } + + // Collect field and sequence data. + var fieldNodes []*Node // nf × (name, delta, col) + var seqNodes []*Node // ns × (name, count, (delta, col)…) + nf, ns := 0, 0 l := len(n.Content) - size := 0 for i := 0; i < l; i += 2 { - if isScalar(n.Content[i+1]) { - size += 2 + k := n.Content[i] + v := n.Content[i+1] + if isOrigin(k) { + continue } - } - - nodes := make([]*Node, 0, size) - for i := 0; i < l; i += 2 { - if isScalar(n.Content[i+1]) { - nodes = append(nodes, getNodeLocation(n.Content[i])...) + // Record the location of this field's key. + nf++ + fieldNodes = append(fieldNodes, + strNode(k.Value), + intNode(k.Line-key.Line), + intNode(k.Column), + ) + if isSequence(v) { + // Record locations of scalar items within the sequence. + // Format per item: value_str, line_delta, col + var itemNodes []*Node + for _, item := range v.Content { + if item.Kind == ScalarNode { + itemNodes = append(itemNodes, + strNode(item.Value), + intNode(item.Line-key.Line), + intNode(item.Column), + ) + } + } + if len(itemNodes) > 0 { + ns++ + seqNodes = append(seqNodes, strNode(k.Value), intNode(len(itemNodes)/3)) + seqNodes = append(seqNodes, itemNodes...) + } } } + + nodes = append(nodes, intNode(nf)) + nodes = append(nodes, fieldNodes...) + nodes = append(nodes, intNode(ns)) + nodes = append(nodes, seqNodes...) return nodes } -// isOrigin returns true if the key is an "origin" element -// the current implementation is not optimal, as it relies on the key's line number -// a better design would be to use a dedicated field in the Node struct +// isOrigin returns true if the key is a synthetic origin node. +// Synthetic nodes have Line==0 (real YAML lines are 1-based). func isOrigin(key *Node) bool { return key.Line == 0 } -func getNodeLocation(n *Node) []*Node { - return getNamedMap(n.Value, getLocationObject(n)) +func strNode(v string) *Node { + return &Node{Kind: ScalarNode, Tag: "!!str", Value: v} } -func getKeyLocation(n *Node) []*Node { - return getNamedMap("key", getLocationObject(n)) -} - -func getNamedMap(title string, content []*Node) []*Node { - if len(content) == 0 { - return nil - } - - return []*Node{ - { - Kind: ScalarNode, - Tag: "!!str", - Value: title, - }, - getMap(content), - } -} - -func getMap(content []*Node) *Node { - return &Node{ - Kind: MappingNode, - Tag: "!!map", - Content: content, - } -} - -func getLocationObject(key *Node) []*Node { - return []*Node{ - { - Kind: ScalarNode, - Tag: "!!str", - Value: "line", - }, - { - Kind: ScalarNode, - Tag: "!!int", - Value: fmt.Sprintf("%d", key.Line), - }, - { - Kind: ScalarNode, - Tag: "!!str", - Value: "column", - }, - { - Kind: ScalarNode, - Tag: "!!int", - Value: fmt.Sprintf("%d", key.Column), - }, - { - Kind: ScalarNode, - Tag: "!!str", - Value: "name", - }, - { - Kind: ScalarNode, - Tag: "!!string", - Value: key.Value, - }, - } +func intNode(v int) *Node { + return &Node{Kind: ScalarNode, Tag: "!!int", Value: fmt.Sprintf("%d", v)} } diff --git a/vendor/github.com/oasdiff/yaml3/yaml.go b/vendor/github.com/oasdiff/yaml3/yaml.go index a49a19b..9cec8a8 100644 --- a/vendor/github.com/oasdiff/yaml3/yaml.go +++ b/vendor/github.com/oasdiff/yaml3/yaml.go @@ -92,6 +92,7 @@ type Decoder struct { parser *parser knownFields bool origin bool + file string } // NewDecoder returns a new decoder that reads from r. @@ -112,8 +113,9 @@ func (dec *Decoder) KnownFields(enable bool) { // Origin enables the recording of the line and column of the // decoded values in the YAML content. -func (dec *Decoder) Origin(enable bool) { +func (dec *Decoder) Origin(enable bool, file string) { dec.origin = enable + dec.file = file } // Decode reads the next YAML-encoded value from its input @@ -125,6 +127,7 @@ func (dec *Decoder) Decode(v interface{}) (err error) { d := newDecoder() d.knownFields = dec.knownFields d.origin = dec.origin + d.file = dec.file defer handleErr(&err) node := dec.parser.parse() if node == nil { diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/.gitmodules b/vendor/github.com/santhosh-tekuri/jsonschema/v6/.gitmodules new file mode 100644 index 0000000..d14f5ea --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/.gitmodules @@ -0,0 +1,4 @@ +[submodule "testdata/JSON-Schema-Test-Suite"] + path = testdata/JSON-Schema-Test-Suite + url = https://github.com/json-schema-org/JSON-Schema-Test-Suite.git + branch = main diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/.golangci.yml b/vendor/github.com/santhosh-tekuri/jsonschema/v6/.golangci.yml new file mode 100644 index 0000000..6534d53 --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/.golangci.yml @@ -0,0 +1,7 @@ +version: "2" +linters: + enable: + - nakedret + - errname + - godot + - misspell diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/.pre-commit-hooks.yaml b/vendor/github.com/santhosh-tekuri/jsonschema/v6/.pre-commit-hooks.yaml new file mode 100644 index 0000000..695b502 --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/.pre-commit-hooks.yaml @@ -0,0 +1,7 @@ +- id: jsonschema-validate + name: Validate JSON against JSON Schema + description: ensure json files follow specified JSON Schema + entry: jv + language: golang + additional_dependencies: + - ./cmd/jv diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/.swp b/vendor/github.com/santhosh-tekuri/jsonschema/v6/.swp new file mode 100644 index 0000000..e511900 Binary files /dev/null and b/vendor/github.com/santhosh-tekuri/jsonschema/v6/.swp differ diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/LICENSE b/vendor/github.com/santhosh-tekuri/jsonschema/v6/LICENSE new file mode 100644 index 0000000..19dc35b --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/LICENSE @@ -0,0 +1,175 @@ + + Apache License + Version 2.0, January 2004 + http://www.apache.org/licenses/ + + TERMS AND CONDITIONS FOR USE, REPRODUCTION, AND DISTRIBUTION + + 1. Definitions. + + "License" shall mean the terms and conditions for use, reproduction, + and distribution as defined by Sections 1 through 9 of this document. + + "Licensor" shall mean the copyright owner or entity authorized by + the copyright owner that is granting the License. + + "Legal Entity" shall mean the union of the acting entity and all + other entities that control, are controlled by, or are under common + control with that entity. For the purposes of this definition, + "control" means (i) the power, direct or indirect, to cause the + direction or management of such entity, whether by contract or + otherwise, or (ii) ownership of fifty percent (50%) or more of the + outstanding shares, or (iii) beneficial ownership of such entity. + + "You" (or "Your") shall mean an individual or Legal Entity + exercising permissions granted by this License. + + "Source" form shall mean the preferred form for making modifications, + including but not limited to software source code, documentation + source, and configuration files. + + "Object" form shall mean any form resulting from mechanical + transformation or translation of a Source form, including but + not limited to compiled object code, generated documentation, + and conversions to other media types. + + "Work" shall mean the work of authorship, whether in Source or + Object form, made available under the License, as indicated by a + copyright notice that is included in or attached to the work + (an example is provided in the Appendix below). + + "Derivative Works" shall mean any work, whether in Source or Object + form, that is based on (or derived from) the Work and for which the + editorial revisions, annotations, elaborations, or other modifications + represent, as a whole, an original work of authorship. For the purposes + of this License, Derivative Works shall not include works that remain + separable from, or merely link (or bind by name) to the interfaces of, + the Work and Derivative Works thereof. + + "Contribution" shall mean any work of authorship, including + the original version of the Work and any modifications or additions + to that Work or Derivative Works thereof, that is intentionally + submitted to Licensor for inclusion in the Work by the copyright owner + or by an individual or Legal Entity authorized to submit on behalf of + the copyright owner. For the purposes of this definition, "submitted" + means any form of electronic, verbal, or written communication sent + to the Licensor or its representatives, including but not limited to + communication on electronic mailing lists, source code control systems, + and issue tracking systems that are managed by, or on behalf of, the + Licensor for the purpose of discussing and improving the Work, but + excluding communication that is conspicuously marked or otherwise + designated in writing by the copyright owner as "Not a Contribution." + + "Contributor" shall mean Licensor and any individual or Legal Entity + on behalf of whom a Contribution has been received by Licensor and + subsequently incorporated within the Work. + + 2. Grant of Copyright License. Subject to the terms and conditions of + this License, each Contributor hereby grants to You a perpetual, + worldwide, non-exclusive, no-charge, royalty-free, irrevocable + copyright license to reproduce, prepare Derivative Works of, + publicly display, publicly perform, sublicense, and distribute the + Work and such Derivative Works in Source or Object form. + + 3. Grant of Patent License. Subject to the terms and conditions of + this License, each Contributor hereby grants to You a perpetual, + worldwide, non-exclusive, no-charge, royalty-free, irrevocable + (except as stated in this section) patent license to make, have made, + use, offer to sell, sell, import, and otherwise transfer the Work, + where such license applies only to those patent claims licensable + by such Contributor that are necessarily infringed by their + Contribution(s) alone or by combination of their Contribution(s) + with the Work to which such Contribution(s) was submitted. If You + institute patent litigation against any entity (including a + cross-claim or counterclaim in a lawsuit) alleging that the Work + or a Contribution incorporated within the Work constitutes direct + or contributory patent infringement, then any patent licenses + granted to You under this License for that Work shall terminate + as of the date such litigation is filed. + + 4. Redistribution. You may reproduce and distribute copies of the + Work or Derivative Works thereof in any medium, with or without + modifications, and in Source or Object form, provided that You + meet the following conditions: + + (a) You must give any other recipients of the Work or + Derivative Works a copy of this License; and + + (b) You must cause any modified files to carry prominent notices + stating that You changed the files; and + + (c) You must retain, in the Source form of any Derivative Works + that You distribute, all copyright, patent, trademark, and + attribution notices from the Source form of the Work, + excluding those notices that do not pertain to any part of + the Derivative Works; and + + (d) If the Work includes a "NOTICE" text file as part of its + distribution, then any Derivative Works that You distribute must + include a readable copy of the attribution notices contained + within such NOTICE file, excluding those notices that do not + pertain to any part of the Derivative Works, in at least one + of the following places: within a NOTICE text file distributed + as part of the Derivative Works; within the Source form or + documentation, if provided along with the Derivative Works; or, + within a display generated by the Derivative Works, if and + wherever such third-party notices normally appear. The contents + of the NOTICE file are for informational purposes only and + do not modify the License. You may add Your own attribution + notices within Derivative Works that You distribute, alongside + or as an addendum to the NOTICE text from the Work, provided + that such additional attribution notices cannot be construed + as modifying the License. + + You may add Your own copyright statement to Your modifications and + may provide additional or different license terms and conditions + for use, reproduction, or distribution of Your modifications, or + for any such Derivative Works as a whole, provided Your use, + reproduction, and distribution of the Work otherwise complies with + the conditions stated in this License. + + 5. Submission of Contributions. Unless You explicitly state otherwise, + any Contribution intentionally submitted for inclusion in the Work + by You to the Licensor shall be under the terms and conditions of + this License, without any additional terms or conditions. + Notwithstanding the above, nothing herein shall supersede or modify + the terms of any separate license agreement you may have executed + with Licensor regarding such Contributions. + + 6. Trademarks. This License does not grant permission to use the trade + names, trademarks, service marks, or product names of the Licensor, + except as required for reasonable and customary use in describing the + origin of the Work and reproducing the content of the NOTICE file. + + 7. Disclaimer of Warranty. Unless required by applicable law or + agreed to in writing, Licensor provides the Work (and each + Contributor provides its Contributions) on an "AS IS" BASIS, + WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or + implied, including, without limitation, any warranties or conditions + of TITLE, NON-INFRINGEMENT, MERCHANTABILITY, or FITNESS FOR A + PARTICULAR PURPOSE. You are solely responsible for determining the + appropriateness of using or redistributing the Work and assume any + risks associated with Your exercise of permissions under this License. + + 8. Limitation of Liability. In no event and under no legal theory, + whether in tort (including negligence), contract, or otherwise, + unless required by applicable law (such as deliberate and grossly + negligent acts) or agreed to in writing, shall any Contributor be + liable to You for damages, including any direct, indirect, special, + incidental, or consequential damages of any character arising as a + result of this License or out of the use or inability to use the + Work (including but not limited to damages for loss of goodwill, + work stoppage, computer failure or malfunction, or any and all + other commercial damages or losses), even if such Contributor + has been advised of the possibility of such damages. + + 9. Accepting Warranty or Additional Liability. While redistributing + the Work or Derivative Works thereof, You may choose to offer, + and charge a fee for, acceptance of support, warranty, indemnity, + or other liability obligations and/or rights consistent with this + License. However, in accepting such obligations, You may act only + on Your own behalf and on Your sole responsibility, not on behalf + of any other Contributor, and only if You agree to indemnify, + defend, and hold each Contributor harmless for any liability + incurred by, or claims asserted against, such Contributor by reason + of your accepting any such warranty or additional liability. \ No newline at end of file diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/README.md b/vendor/github.com/santhosh-tekuri/jsonschema/v6/README.md new file mode 100644 index 0000000..1243b66 --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/README.md @@ -0,0 +1,88 @@ +# jsonschema v6.0.2 + +[![License](https://img.shields.io/badge/License-Apache%202.0-blue.svg)](https://opensource.org/licenses/Apache-2.0) +[![GoDoc](https://godoc.org/github.com/santhosh-tekuri/jsonschema?status.svg)](https://pkg.go.dev/github.com/santhosh-tekuri/jsonschema/v6) +[![Go Report Card](https://goreportcard.com/badge/github.com/santhosh-tekuri/jsonschema/v6)](https://goreportcard.com/report/github.com/santhosh-tekuri/jsonschema/v6) +[![Build Status](https://github.com/santhosh-tekuri/jsonschema/actions/workflows/go.yaml/badge.svg?branch=boon)](https://github.com/santhosh-tekuri/jsonschema/actions/workflows/go.yaml) +[![codecov](https://codecov.io/gh/santhosh-tekuri/jsonschema/branch/boon/graph/badge.svg?token=JMVj1pFT2l)](https://codecov.io/gh/santhosh-tekuri/jsonschema/tree/boon) + +see [godoc](https://pkg.go.dev/github.com/santhosh-tekuri/jsonschema/v6) for examples + +## Library Features + +- [x] pass [JSON-Schema-Test-Suite](https://github.com/json-schema-org/JSON-Schema-Test-Suite) excluding optional(compare with other impls at [bowtie](https://bowtie-json-schema.github.io/bowtie/#)) + - [x] [![draft-04](https://img.shields.io/endpoint?url=https://bowtie.report/badges/go-jsonschema/compliance/draft4.json)](https://bowtie.report/#/dialects/draft4) + - [x] [![draft-06](https://img.shields.io/endpoint?url=https://bowtie.report/badges/go-jsonschema/compliance/draft6.json)](https://bowtie.report/#/dialects/draft6) + - [x] [![draft-07](https://img.shields.io/endpoint?url=https://bowtie.report/badges/go-jsonschema/compliance/draft7.json)](https://bowtie.report/#/dialects/draft7) + - [x] [![draft/2019-09](https://img.shields.io/endpoint?url=https://bowtie.report/badges/go-jsonschema/compliance/draft2019-09.json)](https://bowtie.report/#/dialects/draft2019-09) + - [x] [![draft/2020-12](https://img.shields.io/endpoint?url=https://bowtie.report/badges/go-jsonschema/compliance/draft2020-12.json)](https://bowtie.report/#/dialects/draft2020-12) +- [x] detect infinite loop traps + - [x] `$schema` cycle + - [x] validation cycle +- [x] custom `$schema` url +- [x] vocabulary based validation +- [x] custom regex engine +- [x] format assertions + - [x] flag to enable in draft >= 2019-09 + - [x] custom format registration + - [x] built-in formats + - [x] regex, uuid + - [x] ipv4, ipv6 + - [x] hostname, email + - [x] date, time, date-time, duration + - [x] json-pointer, relative-json-pointer + - [x] uri, uri-reference, uri-template + - [x] iri, iri-reference + - [x] period, semver +- [x] content assertions + - [x] flag to enable in draft >= 7 + - [x] contentEncoding + - [x] base64 + - [x] custom + - [x] contentMediaType + - [x] application/json + - [x] custom + - [x] contentSchema +- [x] errors + - [x] introspectable + - [x] hierarchy + - [x] alternative display with `#` + - [x] output + - [x] flag + - [x] basic + - [x] detailed +- [x] custom vocabulary + - enable via `$vocabulary` for draft >=2019-19 + - enable via flag for draft <= 7 +- [x] mixed dialect support + +## CLI v0.7.0 + +to install: `go install github.com/santhosh-tekuri/jsonschema/cmd/jv@latest` + +Note that the cli is versioned independently. you can see it in git tags `cmd/jv/v0.7.0` + +``` +Usage: jv [OPTIONS] SCHEMA [INSTANCE...] + +Options: + -c, --assert-content Enable content assertions with draft >= 7 + -f, --assert-format Enable format assertions with draft >= 2019 + --cacert pem-file Use the specified pem-file to verify the peer. The file may contain multiple CA certificates + -d, --draft version Draft version used when '$schema' is missing. Valid values 4, 6, 7, 2019, 2020 (default 2020) + -h, --help Print help information + -k, --insecure Use insecure TLS connection + -o, --output format Output format. Valid values simple, alt, flag, basic, detailed (default "simple") + -q, --quiet Do not print errors + -v, --version Print build information +``` + +- [x] exit code `1` for validation errors, `2` for usage errors +- [x] validate both schema and multiple instances +- [x] support both json and yaml files +- [x] support standard input, use `-` +- [x] quite mode with parsable output +- [x] http(s) url support + - [x] custom certs for validation, use `--cacert` + - [x] flag to skip certificate verification, use `--insecure` + diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/compiler.go b/vendor/github.com/santhosh-tekuri/jsonschema/v6/compiler.go new file mode 100644 index 0000000..4da7361 --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/compiler.go @@ -0,0 +1,332 @@ +package jsonschema + +import ( + "fmt" + "regexp" + "slices" +) + +// Compiler compiles json schema into *Schema. +type Compiler struct { + schemas map[urlPtr]*Schema + roots *roots + formats map[string]*Format + decoders map[string]*Decoder + mediaTypes map[string]*MediaType + assertFormat bool + assertContent bool +} + +// NewCompiler create Compiler Object. +func NewCompiler() *Compiler { + return &Compiler{ + schemas: map[urlPtr]*Schema{}, + roots: newRoots(), + formats: map[string]*Format{}, + decoders: map[string]*Decoder{}, + mediaTypes: map[string]*MediaType{}, + assertFormat: false, + assertContent: false, + } +} + +// DefaultDraft overrides the draft used to +// compile schemas without `$schema` field. +// +// By default, this library uses the latest +// draft supported. +// +// The use of this option is HIGHLY encouraged +// to ensure continued correct operation of your +// schema. The current default value will not stay +// the same overtime. +func (c *Compiler) DefaultDraft(d *Draft) { + c.roots.defaultDraft = d +} + +// AssertFormat always enables format assertions. +// +// Default Behavior: +// for draft-07: enabled. +// for draft/2019-09: disabled unless metaschema says `format` vocabulary is required. +// for draft/2020-12: disabled unless metaschema says `format-assertion` vocabulary is required. +func (c *Compiler) AssertFormat() { + c.assertFormat = true +} + +// AssertContent enables content assertions. +// +// Content assertions include keywords: +// - contentEncoding +// - contentMediaType +// - contentSchema +// +// Default behavior is always disabled. +func (c *Compiler) AssertContent() { + c.assertContent = true +} + +// RegisterFormat registers custom format. +// +// NOTE: +// - "regex" format can not be overridden +// - format assertions are disabled for draft >= 2019-09 +// see [Compiler.AssertFormat] +func (c *Compiler) RegisterFormat(f *Format) { + if f.Name != "regex" { + c.formats[f.Name] = f + } +} + +// RegisterContentEncoding registers custom contentEncoding. +// +// NOTE: content assertions are disabled by default. +// see [Compiler.AssertContent]. +func (c *Compiler) RegisterContentEncoding(d *Decoder) { + c.decoders[d.Name] = d +} + +// RegisterContentMediaType registers custom contentMediaType. +// +// NOTE: content assertions are disabled by default. +// see [Compiler.AssertContent]. +func (c *Compiler) RegisterContentMediaType(mt *MediaType) { + c.mediaTypes[mt.Name] = mt +} + +// RegisterVocabulary registers custom vocabulary. +// +// NOTE: +// - vocabularies are disabled for draft >= 2019-09 +// see [Compiler.AssertVocabs] +func (c *Compiler) RegisterVocabulary(vocab *Vocabulary) { + c.roots.vocabularies[vocab.URL] = vocab +} + +// AssertVocabs always enables user-defined vocabularies assertions. +// +// Default Behavior: +// for draft-07: enabled. +// for draft/2019-09: disabled unless metaschema enables a vocabulary. +// for draft/2020-12: disabled unless metaschema enables a vocabulary. +func (c *Compiler) AssertVocabs() { + c.roots.assertVocabs = true +} + +// AddResource adds schema resource which gets used later in reference +// resolution. +// +// The argument url can be file path or url. Any fragment in url is ignored. +// The argument doc must be valid json value. +func (c *Compiler) AddResource(url string, doc any) error { + uf, err := absolute(url) + if err != nil { + return err + } + if isMeta(string(uf.url)) { + return &ResourceExistsError{string(uf.url)} + } + if !c.roots.loader.add(uf.url, doc) { + return &ResourceExistsError{string(uf.url)} + } + return nil +} + +// UseLoader overrides the default [URLLoader] used +// to load schema resources. +func (c *Compiler) UseLoader(loader URLLoader) { + c.roots.loader.loader = loader +} + +// UseRegexpEngine changes the regexp-engine used. +// By default it uses regexp package from go standard +// library. +// +// NOTE: must be called before compiling any schemas. +func (c *Compiler) UseRegexpEngine(engine RegexpEngine) { + if engine == nil { + engine = goRegexpCompile + } + c.roots.regexpEngine = engine +} + +func (c *Compiler) enqueue(q *queue, up urlPtr) *Schema { + if sch, ok := c.schemas[up]; ok { + // already got compiled + return sch + } + if sch := q.get(up); sch != nil { + return sch + } + sch := newSchema(up) + q.append(sch) + return sch +} + +// MustCompile is like [Compile] but panics if compilation fails. +// It simplifies safe initialization of global variables holding +// compiled schema. +func (c *Compiler) MustCompile(loc string) *Schema { + sch, err := c.Compile(loc) + if err != nil { + panic(fmt.Sprintf("jsonschema: Compile(%q): %v", loc, err)) + } + return sch +} + +// Compile compiles json-schema at given loc. +func (c *Compiler) Compile(loc string) (*Schema, error) { + uf, err := absolute(loc) + if err != nil { + return nil, err + } + up, err := c.roots.resolveFragment(*uf) + if err != nil { + return nil, err + } + return c.doCompile(up) +} + +func (c *Compiler) doCompile(up urlPtr) (*Schema, error) { + q := &queue{} + compiled := 0 + + c.enqueue(q, up) + for q.len() > compiled { + sch := q.at(compiled) + if err := c.roots.ensureSubschema(sch.up); err != nil { + return nil, err + } + r := c.roots.roots[sch.up.url] + v, err := sch.up.lookup(r.doc) + if err != nil { + return nil, err + } + if err := c.compileValue(v, sch, r, q); err != nil { + return nil, err + } + compiled++ + } + for _, sch := range *q { + c.schemas[sch.up] = sch + } + return c.schemas[up], nil +} + +func (c *Compiler) compileValue(v any, sch *Schema, r *root, q *queue) error { + res := r.resource(sch.up.ptr) + sch.DraftVersion = res.dialect.draft.version + + base := urlPtr{sch.up.url, res.ptr} + sch.resource = c.enqueue(q, base) + + // if resource, enqueue dynamic anchors for compilation + if sch.DraftVersion >= 2020 && sch.up == sch.resource.up { + res := r.resource(sch.up.ptr) + for anchor, anchorPtr := range res.anchors { + if slices.Contains(res.dynamicAnchors, anchor) { + up := urlPtr{sch.up.url, anchorPtr} + danchorSch := c.enqueue(q, up) + if sch.dynamicAnchors == nil { + sch.dynamicAnchors = map[string]*Schema{} + } + sch.dynamicAnchors[string(anchor)] = danchorSch + } + } + } + + switch v := v.(type) { + case bool: + sch.Bool = &v + case map[string]any: + if err := c.compileObject(v, sch, r, q); err != nil { + return err + } + } + + sch.allPropsEvaluated = sch.AdditionalProperties != nil + if sch.DraftVersion < 2020 { + sch.allItemsEvaluated = sch.AdditionalItems != nil + switch items := sch.Items.(type) { + case *Schema: + sch.allItemsEvaluated = true + case []*Schema: + sch.numItemsEvaluated = len(items) + } + } else { + sch.allItemsEvaluated = sch.Items2020 != nil + sch.numItemsEvaluated = len(sch.PrefixItems) + } + + return nil +} + +func (c *Compiler) compileObject(obj map[string]any, sch *Schema, r *root, q *queue) error { + if len(obj) == 0 { + b := true + sch.Bool = &b + return nil + } + oc := objCompiler{ + c: c, + obj: obj, + up: sch.up, + r: r, + res: r.resource(sch.up.ptr), + q: q, + } + return oc.compile(sch) +} + +// queue -- + +type queue []*Schema + +func (q *queue) append(sch *Schema) { + *q = append(*q, sch) +} + +func (q *queue) at(i int) *Schema { + return (*q)[i] +} + +func (q *queue) len() int { + return len(*q) +} + +func (q *queue) get(up urlPtr) *Schema { + i := slices.IndexFunc(*q, func(sch *Schema) bool { return sch.up == up }) + if i != -1 { + return (*q)[i] + } + return nil +} + +// regexp -- + +// Regexp is the representation of compiled regular expression. +type Regexp interface { + fmt.Stringer + + // MatchString reports whether the string s contains + // any match of the regular expression. + MatchString(string) bool +} + +// RegexpEngine parses a regular expression and returns, +// if successful, a Regexp object that can be used to +// match against text. +type RegexpEngine func(string) (Regexp, error) + +func (re RegexpEngine) validate(v any) error { + s, ok := v.(string) + if !ok { + return nil + } + _, err := re(s) + return err +} + +func goRegexpCompile(s string) (Regexp, error) { + return regexp.Compile(s) +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/content.go b/vendor/github.com/santhosh-tekuri/jsonschema/v6/content.go new file mode 100644 index 0000000..8d62e58 --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/content.go @@ -0,0 +1,51 @@ +package jsonschema + +import ( + "bytes" + "encoding/base64" + "encoding/json" +) + +// Decoder specifies how to decode specific contentEncoding. +type Decoder struct { + // Name of contentEncoding. + Name string + // Decode given string to byte array. + Decode func(string) ([]byte, error) +} + +var decoders = map[string]*Decoder{ + "base64": { + Name: "base64", + Decode: func(s string) ([]byte, error) { + return base64.StdEncoding.DecodeString(s) + }, + }, +} + +// MediaType specified how to validate bytes against specific contentMediaType. +type MediaType struct { + // Name of contentMediaType. + Name string + + // Validate checks whether bytes conform to this mediatype. + Validate func([]byte) error + + // UnmarshalJSON unmarshals bytes into json value. + // This must be nil if this mediatype is not compatible + // with json. + UnmarshalJSON func([]byte) (any, error) +} + +var mediaTypes = map[string]*MediaType{ + "application/json": { + Name: "application/json", + Validate: func(b []byte) error { + var v any + return json.Unmarshal(b, &v) + }, + UnmarshalJSON: func(b []byte) (any, error) { + return UnmarshalJSON(bytes.NewReader(b)) + }, + }, +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/draft.go b/vendor/github.com/santhosh-tekuri/jsonschema/v6/draft.go new file mode 100644 index 0000000..fd09bae --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/draft.go @@ -0,0 +1,360 @@ +package jsonschema + +import ( + "fmt" + "slices" + "strings" +) + +// A Draft represents json-schema specification. +type Draft struct { + version int + url string + sch *Schema + id string // property name used to represent id + subschemas []SchemaPath // locations of subschemas + vocabPrefix string // prefix used for vocabulary + allVocabs map[string]*Schema // names of supported vocabs with its schemas + defaultVocabs []string // names of default vocabs +} + +// String returns the specification url. +func (d *Draft) String() string { + return d.url +} + +var ( + Draft4 = &Draft{ + version: 4, + url: "http://json-schema.org/draft-04/schema", + id: "id", + subschemas: []SchemaPath{ + // type agonistic + schemaPath("definitions/*"), + schemaPath("not"), + schemaPath("allOf/[]"), + schemaPath("anyOf/[]"), + schemaPath("oneOf/[]"), + // object + schemaPath("properties/*"), + schemaPath("additionalProperties"), + schemaPath("patternProperties/*"), + // array + schemaPath("items"), + schemaPath("items/[]"), + schemaPath("additionalItems"), + schemaPath("dependencies/*"), + }, + vocabPrefix: "", + allVocabs: map[string]*Schema{}, + defaultVocabs: []string{}, + } + + Draft6 = &Draft{ + version: 6, + url: "http://json-schema.org/draft-06/schema", + id: "$id", + subschemas: joinSubschemas(Draft4.subschemas, + schemaPath("propertyNames"), + schemaPath("contains"), + ), + vocabPrefix: "", + allVocabs: map[string]*Schema{}, + defaultVocabs: []string{}, + } + + Draft7 = &Draft{ + version: 7, + url: "http://json-schema.org/draft-07/schema", + id: "$id", + subschemas: joinSubschemas(Draft6.subschemas, + schemaPath("if"), + schemaPath("then"), + schemaPath("else"), + ), + vocabPrefix: "", + allVocabs: map[string]*Schema{}, + defaultVocabs: []string{}, + } + + Draft2019 = &Draft{ + version: 2019, + url: "https://json-schema.org/draft/2019-09/schema", + id: "$id", + subschemas: joinSubschemas(Draft7.subschemas, + schemaPath("$defs/*"), + schemaPath("dependentSchemas/*"), + schemaPath("unevaluatedProperties"), + schemaPath("unevaluatedItems"), + schemaPath("contentSchema"), + ), + vocabPrefix: "https://json-schema.org/draft/2019-09/vocab/", + allVocabs: map[string]*Schema{ + "core": nil, + "applicator": nil, + "validation": nil, + "meta-data": nil, + "format": nil, + "content": nil, + }, + defaultVocabs: []string{"core", "applicator", "validation"}, + } + + Draft2020 = &Draft{ + version: 2020, + url: "https://json-schema.org/draft/2020-12/schema", + id: "$id", + subschemas: joinSubschemas(Draft2019.subschemas, + schemaPath("prefixItems/[]"), + ), + vocabPrefix: "https://json-schema.org/draft/2020-12/vocab/", + allVocabs: map[string]*Schema{ + "core": nil, + "applicator": nil, + "unevaluated": nil, + "validation": nil, + "meta-data": nil, + "format-annotation": nil, + "format-assertion": nil, + "content": nil, + }, + defaultVocabs: []string{"core", "applicator", "unevaluated", "validation"}, + } + + draftLatest = Draft2020 +) + +func init() { + c := NewCompiler() + c.AssertFormat() + for _, d := range []*Draft{Draft4, Draft6, Draft7, Draft2019, Draft2020} { + d.sch = c.MustCompile(d.url) + for name := range d.allVocabs { + d.allVocabs[name] = c.MustCompile(strings.TrimSuffix(d.url, "schema") + "meta/" + name) + } + } +} + +func draftFromURL(url string) *Draft { + u, frag := split(url) + if frag != "" { + return nil + } + u, ok := strings.CutPrefix(u, "http://") + if !ok { + u, _ = strings.CutPrefix(u, "https://") + } + switch u { + case "json-schema.org/schema": + return draftLatest + case "json-schema.org/draft/2020-12/schema": + return Draft2020 + case "json-schema.org/draft/2019-09/schema": + return Draft2019 + case "json-schema.org/draft-07/schema": + return Draft7 + case "json-schema.org/draft-06/schema": + return Draft6 + case "json-schema.org/draft-04/schema": + return Draft4 + default: + return nil + } +} + +func (d *Draft) getID(obj map[string]any) string { + if d.version < 2019 { + if _, ok := obj["$ref"]; ok { + // All other properties in a "$ref" object MUST be ignored + return "" + } + } + + id, ok := strVal(obj, d.id) + if !ok { + return "" + } + id, _ = split(id) // ignore fragment + return id +} + +func (d *Draft) getVocabs(url url, doc any, vocabularies map[string]*Vocabulary) ([]string, error) { + if d.version < 2019 { + return nil, nil + } + obj, ok := doc.(map[string]any) + if !ok { + return nil, nil + } + v, ok := obj["$vocabulary"] + if !ok { + return nil, nil + } + obj, ok = v.(map[string]any) + if !ok { + return nil, nil + } + + var vocabs []string + for vocab, reqd := range obj { + if reqd, ok := reqd.(bool); !ok || !reqd { + continue + } + name, ok := strings.CutPrefix(vocab, d.vocabPrefix) + if ok { + if _, ok := d.allVocabs[name]; ok { + if !slices.Contains(vocabs, name) { + vocabs = append(vocabs, name) + continue + } + } + } + if _, ok := vocabularies[vocab]; !ok { + return nil, &UnsupportedVocabularyError{url.String(), vocab} + } + if !slices.Contains(vocabs, vocab) { + vocabs = append(vocabs, vocab) + } + } + if !slices.Contains(vocabs, "core") { + vocabs = append(vocabs, "core") + } + return vocabs, nil +} + +// -- + +type dialect struct { + draft *Draft + vocabs []string // nil means use draft.defaultVocabs +} + +func (d *dialect) hasVocab(name string) bool { + if name == "core" || d.draft.version < 2019 { + return true + } + if d.vocabs != nil { + return slices.Contains(d.vocabs, name) + } + return slices.Contains(d.draft.defaultVocabs, name) +} + +func (d *dialect) activeVocabs(assertVocabs bool, vocabularies map[string]*Vocabulary) []string { + if len(vocabularies) == 0 { + return d.vocabs + } + if d.draft.version < 2019 { + assertVocabs = true + } + if !assertVocabs { + return d.vocabs + } + var vocabs []string + if d.vocabs == nil { + vocabs = slices.Clone(d.draft.defaultVocabs) + } else { + vocabs = slices.Clone(d.vocabs) + } + for vocab := range vocabularies { + if !slices.Contains(vocabs, vocab) { + vocabs = append(vocabs, vocab) + } + } + return vocabs +} + +func (d *dialect) getSchema(assertVocabs bool, vocabularies map[string]*Vocabulary) *Schema { + vocabs := d.activeVocabs(assertVocabs, vocabularies) + if vocabs == nil { + return d.draft.sch + } + + var allOf []*Schema + for _, vocab := range vocabs { + sch := d.draft.allVocabs[vocab] + if sch == nil { + if v, ok := vocabularies[vocab]; ok { + sch = v.Schema + } + } + if sch != nil { + allOf = append(allOf, sch) + } + } + if !slices.Contains(vocabs, "core") { + sch := d.draft.allVocabs["core"] + if sch == nil { + sch = d.draft.sch + } + allOf = append(allOf, sch) + } + sch := &Schema{ + Location: "urn:mem:metaschema", + up: urlPtr{url("urn:mem:metaschema"), ""}, + DraftVersion: d.draft.version, + AllOf: allOf, + } + sch.resource = sch + if sch.DraftVersion >= 2020 { + sch.DynamicAnchor = "meta" + sch.dynamicAnchors = map[string]*Schema{ + "meta": sch, + } + } + return sch +} + +// -- + +type ParseIDError struct { + URL string +} + +func (e *ParseIDError) Error() string { + return fmt.Sprintf("error in parsing id at %q", e.URL) +} + +// -- + +type ParseAnchorError struct { + URL string +} + +func (e *ParseAnchorError) Error() string { + return fmt.Sprintf("error in parsing anchor at %q", e.URL) +} + +// -- + +type DuplicateIDError struct { + ID string + URL string + Ptr1 string + Ptr2 string +} + +func (e *DuplicateIDError) Error() string { + return fmt.Sprintf("duplicate id %q in %q at %q and %q", e.ID, e.URL, e.Ptr1, e.Ptr2) +} + +// -- + +type DuplicateAnchorError struct { + Anchor string + URL string + Ptr1 string + Ptr2 string +} + +func (e *DuplicateAnchorError) Error() string { + return fmt.Sprintf("duplicate anchor %q in %q at %q and %q", e.Anchor, e.URL, e.Ptr1, e.Ptr2) +} + +// -- + +func joinSubschemas(a1 []SchemaPath, a2 ...SchemaPath) []SchemaPath { + var a []SchemaPath + a = append(a, a1...) + a = append(a, a2...) + return a +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/format.go b/vendor/github.com/santhosh-tekuri/jsonschema/v6/format.go new file mode 100644 index 0000000..b78b22e --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/format.go @@ -0,0 +1,708 @@ +package jsonschema + +import ( + "net/netip" + gourl "net/url" + "strconv" + "strings" + "time" +) + +// Format defined specific format. +type Format struct { + // Name of format. + Name string + + // Validate checks if given value is of this format. + Validate func(v any) error +} + +var formats = map[string]*Format{ + "json-pointer": {"json-pointer", validateJSONPointer}, + "relative-json-pointer": {"relative-json-pointer", validateRelativeJSONPointer}, + "uuid": {"uuid", validateUUID}, + "duration": {"duration", validateDuration}, + "period": {"period", validatePeriod}, + "ipv4": {"ipv4", validateIPV4}, + "ipv6": {"ipv6", validateIPV6}, + "hostname": {"hostname", validateHostname}, + "email": {"email", validateEmail}, + "date": {"date", validateDate}, + "time": {"time", validateTime}, + "date-time": {"date-time", validateDateTime}, + "uri": {"uri", validateURI}, + "iri": {"iri", validateURI}, + "uri-reference": {"uri-reference", validateURIReference}, + "iri-reference": {"iri-reference", validateURIReference}, + "uri-template": {"uri-template", validateURITemplate}, + "semver": {"semver", validateSemver}, +} + +// see https://www.rfc-editor.org/rfc/rfc6901#section-3 +func validateJSONPointer(v any) error { + s, ok := v.(string) + if !ok { + return nil + } + if s == "" { + return nil + } + if !strings.HasPrefix(s, "/") { + return LocalizableError("not starting with /") + } + for _, tok := range strings.Split(s, "/")[1:] { + escape := false + for _, ch := range tok { + if escape { + escape = false + if ch != '0' && ch != '1' { + return LocalizableError("~ must be followed by 0 or 1") + } + continue + } + if ch == '~' { + escape = true + continue + } + switch { + case ch >= '\x00' && ch <= '\x2E': + case ch >= '\x30' && ch <= '\x7D': + case ch >= '\x7F' && ch <= '\U0010FFFF': + default: + return LocalizableError("invalid character %q", ch) + } + } + if escape { + return LocalizableError("~ must be followed by 0 or 1") + } + } + return nil +} + +// see https://tools.ietf.org/html/draft-handrews-relative-json-pointer-01#section-3 +func validateRelativeJSONPointer(v any) error { + s, ok := v.(string) + if !ok { + return nil + } + + // start with non-negative-integer + numDigits := 0 + for _, ch := range s { + if ch >= '0' && ch <= '9' { + numDigits++ + } else { + break + } + } + if numDigits == 0 { + return LocalizableError("must start with non-negative integer") + } + if numDigits > 1 && strings.HasPrefix(s, "0") { + return LocalizableError("starts with zero") + } + s = s[numDigits:] + + // followed by either json-pointer or '#' + if s == "#" { + return nil + } + return validateJSONPointer(s) +} + +// see https://datatracker.ietf.org/doc/html/rfc4122#page-4 +func validateUUID(v any) error { + s, ok := v.(string) + if !ok { + return nil + } + + hexGroups := []int{8, 4, 4, 4, 12} + groups := strings.Split(s, "-") + if len(groups) != len(hexGroups) { + return LocalizableError("must have %d elements", len(hexGroups)) + } + for i, group := range groups { + if len(group) != hexGroups[i] { + return LocalizableError("element %d must be %d characters long", i+1, hexGroups[i]) + } + for _, ch := range group { + switch { + case ch >= '0' && ch <= '9': + case ch >= 'a' && ch <= 'f': + case ch >= 'A' && ch <= 'F': + default: + return LocalizableError("non-hex character %q", ch) + } + } + } + return nil +} + +// see https://datatracker.ietf.org/doc/html/rfc3339#appendix-A +func validateDuration(v any) error { + s, ok := v.(string) + if !ok { + return nil + } + + // must start with 'P' + s, ok = strings.CutPrefix(s, "P") + if !ok { + return LocalizableError("must start with P") + } + if s == "" { + return LocalizableError("nothing after P") + } + + // dur-week + if s, ok := strings.CutSuffix(s, "W"); ok { + if s == "" { + return LocalizableError("no number in week") + } + for _, ch := range s { + if ch < '0' || ch > '9' { + return LocalizableError("invalid week") + } + } + return nil + } + + allUnits := []string{"YMD", "HMS"} + for i, s := range strings.Split(s, "T") { + if i != 0 && s == "" { + return LocalizableError("no time elements") + } + if i >= len(allUnits) { + return LocalizableError("more than one T") + } + units := allUnits[i] + for s != "" { + digitCount := 0 + for _, ch := range s { + if ch >= '0' && ch <= '9' { + digitCount++ + } else { + break + } + } + if digitCount == 0 { + return LocalizableError("missing number") + } + s = s[digitCount:] + if s == "" { + return LocalizableError("missing unit") + } + unit := s[0] + j := strings.IndexByte(units, unit) + if j == -1 { + if strings.IndexByte(allUnits[i], unit) != -1 { + return LocalizableError("unit %q out of order", unit) + } + return LocalizableError("invalid unit %q", unit) + } + units = units[j+1:] + s = s[1:] + } + } + + return nil +} + +func validateIPV4(v any) error { + s, ok := v.(string) + if !ok { + return nil + } + groups := strings.Split(s, ".") + if len(groups) != 4 { + return LocalizableError("expected four decimals") + } + for _, group := range groups { + if len(group) > 1 && group[0] == '0' { + return LocalizableError("leading zeros") + } + n, err := strconv.Atoi(group) + if err != nil { + return err + } + if n < 0 || n > 255 { + return LocalizableError("decimal must be between 0 and 255") + } + } + return nil +} + +func validateIPV6(v any) error { + s, ok := v.(string) + if !ok { + return nil + } + if !strings.Contains(s, ":") { + return LocalizableError("missing colon") + } + addr, err := netip.ParseAddr(s) + if err != nil { + return err + } + if addr.Zone() != "" { + return LocalizableError("zone id is not a part of ipv6 address") + } + return nil +} + +// see https://en.wikipedia.org/wiki/Hostname#Restrictions_on_valid_host_names +func validateHostname(v any) error { + s, ok := v.(string) + if !ok { + return nil + } + + // entire hostname (including the delimiting dots but not a trailing dot) has a maximum of 253 ASCII characters + s = strings.TrimSuffix(s, ".") + if len(s) > 253 { + return LocalizableError("more than 253 characters long") + } + + // Hostnames are composed of series of labels concatenated with dots, as are all domain names + for _, label := range strings.Split(s, ".") { + // Each label must be from 1 to 63 characters long + if len(label) < 1 || len(label) > 63 { + return LocalizableError("label must be 1 to 63 characters long") + } + + // labels must not start or end with a hyphen + if strings.HasPrefix(label, "-") { + return LocalizableError("label starts with hyphen") + } + if strings.HasSuffix(label, "-") { + return LocalizableError("label ends with hyphen") + } + + // labels may contain only the ASCII letters 'a' through 'z' (in a case-insensitive manner), + // the digits '0' through '9', and the hyphen ('-') + for _, ch := range label { + switch { + case ch >= 'a' && ch <= 'z': + case ch >= 'A' && ch <= 'Z': + case ch >= '0' && ch <= '9': + case ch == '-': + default: + return LocalizableError("invalid character %q", ch) + } + } + } + return nil +} + +// see https://en.wikipedia.org/wiki/Email_address +func validateEmail(v any) error { + s, ok := v.(string) + if !ok { + return nil + } + // entire email address to be no more than 254 characters long + if len(s) > 254 { + return LocalizableError("more than 255 characters long") + } + + // email address is generally recognized as having two parts joined with an at-sign + at := strings.LastIndexByte(s, '@') + if at == -1 { + return LocalizableError("missing @") + } + local, domain := s[:at], s[at+1:] + + // local part may be up to 64 characters long + if len(local) > 64 { + return LocalizableError("local part more than 64 characters long") + } + + if len(local) > 1 && strings.HasPrefix(local, `"`) && strings.HasPrefix(local, `"`) { + // quoted + local := local[1 : len(local)-1] + if strings.IndexByte(local, '\\') != -1 || strings.IndexByte(local, '"') != -1 { + return LocalizableError("backslash and quote are not allowed within quoted local part") + } + } else { + // unquoted + if strings.HasPrefix(local, ".") { + return LocalizableError("starts with dot") + } + if strings.HasSuffix(local, ".") { + return LocalizableError("ends with dot") + } + + // consecutive dots not allowed + if strings.Contains(local, "..") { + return LocalizableError("consecutive dots") + } + + // check allowed chars + for _, ch := range local { + switch { + case ch >= 'a' && ch <= 'z': + case ch >= 'A' && ch <= 'Z': + case ch >= '0' && ch <= '9': + case strings.ContainsRune(".!#$%&'*+-/=?^_`{|}~", ch): + default: + return LocalizableError("invalid character %q", ch) + } + } + } + + // domain if enclosed in brackets, must match an IP address + if strings.HasPrefix(domain, "[") && strings.HasSuffix(domain, "]") { + domain = domain[1 : len(domain)-1] + if rem, ok := strings.CutPrefix(domain, "IPv6:"); ok { + if err := validateIPV6(rem); err != nil { + return LocalizableError("invalid ipv6 address: %v", err) + } + return nil + } + if err := validateIPV4(domain); err != nil { + return LocalizableError("invalid ipv4 address: %v", err) + } + return nil + } + + // domain must match the requirements for a hostname + if err := validateHostname(domain); err != nil { + return LocalizableError("invalid domain: %v", err) + } + + return nil +} + +// see see https://datatracker.ietf.org/doc/html/rfc3339#section-5.6 +func validateDate(v any) error { + s, ok := v.(string) + if !ok { + return nil + } + _, err := time.Parse("2006-01-02", s) + return err +} + +// see https://datatracker.ietf.org/doc/html/rfc3339#section-5.6 +// NOTE: golang time package does not support leap seconds. +func validateTime(v any) error { + str, ok := v.(string) + if !ok { + return nil + } + + // min: hh:mm:ssZ + if len(str) < 9 { + return LocalizableError("less than 9 characters long") + } + if str[2] != ':' || str[5] != ':' { + return LocalizableError("missing colon in correct place") + } + + // parse hh:mm:ss + var hms []int + for _, tok := range strings.SplitN(str[:8], ":", 3) { + i, err := strconv.Atoi(tok) + if err != nil { + return LocalizableError("invalid hour/min/sec") + } + if i < 0 { + return LocalizableError("non-positive hour/min/sec") + } + hms = append(hms, i) + } + if len(hms) != 3 { + return LocalizableError("missing hour/min/sec") + } + h, m, s := hms[0], hms[1], hms[2] + if h > 23 || m > 59 || s > 60 { + return LocalizableError("hour/min/sec out of range") + } + str = str[8:] + + // parse sec-frac if present + if rem, ok := strings.CutPrefix(str, "."); ok { + numDigits := 0 + for _, ch := range rem { + if ch >= '0' && ch <= '9' { + numDigits++ + } else { + break + } + } + if numDigits == 0 { + return LocalizableError("no digits in second fraction") + } + str = rem[numDigits:] + } + + if str != "z" && str != "Z" { + // parse time-numoffset + if len(str) != 6 { + return LocalizableError("offset must be 6 characters long") + } + var sign int + switch str[0] { + case '+': + sign = -1 + case '-': + sign = +1 + default: + return LocalizableError("offset must begin with plus/minus") + } + str = str[1:] + if str[2] != ':' { + return LocalizableError("missing colon in offset in correct place") + } + + var zhm []int + for _, tok := range strings.SplitN(str, ":", 2) { + i, err := strconv.Atoi(tok) + if err != nil { + return LocalizableError("invalid hour/min in offset") + } + if i < 0 { + return LocalizableError("non-positive hour/min in offset") + } + zhm = append(zhm, i) + } + zh, zm := zhm[0], zhm[1] + if zh > 23 || zm > 59 { + return LocalizableError("hour/min in offset out of range") + } + + // apply timezone + hm := (h*60 + m) + sign*(zh*60+zm) + if hm < 0 { + hm += 24 * 60 + } + h, m = hm/60, hm%60 + } + + // check leap second + if s >= 60 && (h != 23 || m != 59) { + return LocalizableError("invalid leap second") + } + + return nil +} + +// see https://datatracker.ietf.org/doc/html/rfc3339#section-5.6 +func validateDateTime(v any) error { + s, ok := v.(string) + if !ok { + return nil + } + + // min: yyyy-mm-ddThh:mm:ssZ + if len(s) < 20 { + return LocalizableError("less than 20 characters long") + } + + if s[10] != 't' && s[10] != 'T' { + return LocalizableError("11th character must be t or T") + } + if err := validateDate(s[:10]); err != nil { + return LocalizableError("invalid date element: %v", err) + } + if err := validateTime(s[11:]); err != nil { + return LocalizableError("invalid time element: %v", err) + } + return nil +} + +func parseURL(s string) (*gourl.URL, error) { + u, err := gourl.Parse(s) + if err != nil { + return nil, err + } + + // gourl does not validate ipv6 host address + hostName := u.Hostname() + if strings.Contains(hostName, ":") { + if !strings.Contains(u.Host, "[") || !strings.Contains(u.Host, "]") { + return nil, LocalizableError("ipv6 address not enclosed in brackets") + } + if err := validateIPV6(hostName); err != nil { + return nil, LocalizableError("invalid ipv6 address: %v", err) + } + } + + return u, nil +} + +func validateURI(v any) error { + s, ok := v.(string) + if !ok { + return nil + } + u, err := parseURL(s) + if err != nil { + return err + } + if !u.IsAbs() { + return LocalizableError("relative url") + } + return nil +} + +func validateURIReference(v any) error { + s, ok := v.(string) + if !ok { + return nil + } + if strings.Contains(s, `\`) { + return LocalizableError(`contains \`) + } + _, err := parseURL(s) + return err +} + +func validateURITemplate(v any) error { + s, ok := v.(string) + if !ok { + return nil + } + u, err := parseURL(s) + if err != nil { + return err + } + for _, tok := range strings.Split(u.RawPath, "/") { + tok, err = decode(tok) + if err != nil { + return LocalizableError("percent decode failed: %v", err) + } + want := true + for _, ch := range tok { + var got bool + switch ch { + case '{': + got = true + case '}': + got = false + default: + continue + } + if got != want { + return LocalizableError("nested curly braces") + } + want = !want + } + if !want { + return LocalizableError("no matching closing brace") + } + } + return nil +} + +func validatePeriod(v any) error { + s, ok := v.(string) + if !ok { + return nil + } + + slash := strings.IndexByte(s, '/') + if slash == -1 { + return LocalizableError("missing slash") + } + + start, end := s[:slash], s[slash+1:] + if strings.HasPrefix(start, "P") { + if err := validateDuration(start); err != nil { + return LocalizableError("invalid start duration: %v", err) + } + if err := validateDateTime(end); err != nil { + return LocalizableError("invalid end date-time: %v", err) + } + } else { + if err := validateDateTime(start); err != nil { + return LocalizableError("invalid start date-time: %v", err) + } + if strings.HasPrefix(end, "P") { + if err := validateDuration(end); err != nil { + return LocalizableError("invalid end duration: %v", err) + } + } else if err := validateDateTime(end); err != nil { + return LocalizableError("invalid end date-time: %v", err) + } + } + + return nil +} + +// see https://semver.org/#backusnaur-form-grammar-for-valid-semver-versions +func validateSemver(v any) error { + s, ok := v.(string) + if !ok { + return nil + } + + // build -- + if i := strings.IndexByte(s, '+'); i != -1 { + build := s[i+1:] + if build == "" { + return LocalizableError("build is empty") + } + for _, buildID := range strings.Split(build, ".") { + if buildID == "" { + return LocalizableError("build identifier is empty") + } + for _, ch := range buildID { + switch { + case ch >= '0' && ch <= '9': + case (ch >= 'a' && ch <= 'z') || (ch >= 'A' && ch <= 'Z') || ch == '-': + default: + return LocalizableError("invalid character %q in build identifier", ch) + } + } + } + s = s[:i] + } + + // pre-release -- + if i := strings.IndexByte(s, '-'); i != -1 { + preRelease := s[i+1:] + for _, preReleaseID := range strings.Split(preRelease, ".") { + if preReleaseID == "" { + return LocalizableError("pre-release identifier is empty") + } + allDigits := true + for _, ch := range preReleaseID { + switch { + case ch >= '0' && ch <= '9': + case (ch >= 'a' && ch <= 'z') || (ch >= 'A' && ch <= 'Z') || ch == '-': + allDigits = false + default: + return LocalizableError("invalid character %q in pre-release identifier", ch) + } + } + if allDigits && len(preReleaseID) > 1 && preReleaseID[0] == '0' { + return LocalizableError("pre-release numeric identifier starts with zero") + } + } + s = s[:i] + } + + // versionCore -- + versions := strings.Split(s, ".") + if len(versions) != 3 { + return LocalizableError("versionCore must have 3 numbers separated by dot") + } + names := []string{"major", "minor", "patch"} + for i, version := range versions { + if version == "" { + return LocalizableError("%s is empty", names[i]) + } + if len(version) > 1 && version[0] == '0' { + return LocalizableError("%s starts with zero", names[i]) + } + for _, ch := range version { + if ch < '0' || ch > '9' { + return LocalizableError("%s contains non-digit", names[i]) + } + } + } + + return nil +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/go.work b/vendor/github.com/santhosh-tekuri/jsonschema/v6/go.work new file mode 100644 index 0000000..e7f4d93 --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/go.work @@ -0,0 +1,8 @@ +go 1.21.1 + +use ( + . + ./cmd/jv +) + +// replace github.com/santhosh-tekuri/jsonschema/v6 v6.0.2 => ./ diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/go.work.sum b/vendor/github.com/santhosh-tekuri/jsonschema/v6/go.work.sum new file mode 100644 index 0000000..2b5b811 --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/go.work.sum @@ -0,0 +1,4 @@ +github.com/santhosh-tekuri/jsonschema/v6 v6.0.1/go.mod h1:JXeL+ps8p7/KNMjDQk3TCwPpBy0wYklyWTfbkIzdIFU= +golang.org/x/mod v0.8.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs= +golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/tools v0.6.0/go.mod h1:Xwgl3UAJ/d3gWutnCtw505GrjyAbvKui8lOU390QaIU= diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/kind/kind.go b/vendor/github.com/santhosh-tekuri/jsonschema/v6/kind/kind.go new file mode 100644 index 0000000..a37fb0b --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/kind/kind.go @@ -0,0 +1,651 @@ +package kind + +import ( + "fmt" + "math/big" + "strings" + + "golang.org/x/text/message" +) + +// -- + +type InvalidJsonValue struct { + Value any +} + +func (*InvalidJsonValue) KeywordPath() []string { + return nil +} + +func (k *InvalidJsonValue) LocalizedString(p *message.Printer) string { + return p.Sprintf("invalid jsonType %T", k.Value) +} + +// -- + +type Schema struct { + Location string +} + +func (*Schema) KeywordPath() []string { + return nil +} + +func (k *Schema) LocalizedString(p *message.Printer) string { + return p.Sprintf("jsonschema validation failed with %s", quote(k.Location)) +} + +// -- + +type Group struct{} + +func (*Group) KeywordPath() []string { + return nil +} + +func (*Group) LocalizedString(p *message.Printer) string { + return p.Sprintf("validation failed") +} + +// -- + +type Not struct{} + +func (*Not) KeywordPath() []string { + return nil +} + +func (*Not) LocalizedString(p *message.Printer) string { + return p.Sprintf("'not' failed") +} + +// -- + +type AllOf struct{} + +func (*AllOf) KeywordPath() []string { + return []string{"allOf"} +} + +func (*AllOf) LocalizedString(p *message.Printer) string { + return p.Sprintf("'allOf' failed") +} + +// -- + +type AnyOf struct{} + +func (*AnyOf) KeywordPath() []string { + return []string{"anyOf"} +} + +func (*AnyOf) LocalizedString(p *message.Printer) string { + return p.Sprintf("'anyOf' failed") +} + +// -- + +type OneOf struct { + // Subschemas gives indexes of Subschemas that have matched. + // Value nil, means none of the subschemas matched. + Subschemas []int +} + +func (*OneOf) KeywordPath() []string { + return []string{"oneOf"} +} + +func (k *OneOf) LocalizedString(p *message.Printer) string { + if len(k.Subschemas) == 0 { + return p.Sprintf("'oneOf' failed, none matched") + } + return p.Sprintf("'oneOf' failed, subschemas %d, %d matched", k.Subschemas[0], k.Subschemas[1]) +} + +//-- + +type FalseSchema struct{} + +func (*FalseSchema) KeywordPath() []string { + return nil +} + +func (*FalseSchema) LocalizedString(p *message.Printer) string { + return p.Sprintf("false schema") +} + +// -- + +type RefCycle struct { + URL string + KeywordLocation1 string + KeywordLocation2 string +} + +func (*RefCycle) KeywordPath() []string { + return nil +} + +func (k *RefCycle) LocalizedString(p *message.Printer) string { + return p.Sprintf("both %s and %s resolve to %q causing reference cycle", k.KeywordLocation1, k.KeywordLocation2, k.URL) +} + +// -- + +type Type struct { + Got string + Want []string +} + +func (*Type) KeywordPath() []string { + return []string{"type"} +} + +func (k *Type) LocalizedString(p *message.Printer) string { + want := strings.Join(k.Want, " or ") + return p.Sprintf("got %s, want %s", k.Got, want) +} + +// -- + +type Enum struct { + Got any + Want []any +} + +// KeywordPath implements jsonschema.ErrorKind. +func (*Enum) KeywordPath() []string { + return []string{"enum"} +} + +func (k *Enum) LocalizedString(p *message.Printer) string { + allPrimitive := true +loop: + for _, item := range k.Want { + switch item.(type) { + case []any, map[string]any: + allPrimitive = false + break loop + } + } + if allPrimitive { + if len(k.Want) == 1 { + return p.Sprintf("value must be %s", display(k.Want[0])) + } + var want []string + for _, v := range k.Want { + want = append(want, display(v)) + } + return p.Sprintf("value must be one of %s", strings.Join(want, ", ")) + } + return p.Sprintf("'enum' failed") +} + +// -- + +type Const struct { + Got any + Want any +} + +func (*Const) KeywordPath() []string { + return []string{"const"} +} + +func (k *Const) LocalizedString(p *message.Printer) string { + switch want := k.Want.(type) { + case []any, map[string]any: + return p.Sprintf("'const' failed") + default: + return p.Sprintf("value must be %s", display(want)) + } +} + +// -- + +type Format struct { + Got any + Want string + Err error +} + +func (*Format) KeywordPath() []string { + return []string{"format"} +} + +func (k *Format) LocalizedString(p *message.Printer) string { + return p.Sprintf("%s is not valid %s: %v", display(k.Got), k.Want, localizedError(k.Err, p)) +} + +// -- + +type Reference struct { + Keyword string + URL string +} + +func (k *Reference) KeywordPath() []string { + return []string{k.Keyword} +} + +func (*Reference) LocalizedString(p *message.Printer) string { + return p.Sprintf("validation failed") +} + +// -- + +type MinProperties struct { + Got, Want int +} + +func (*MinProperties) KeywordPath() []string { + return []string{"minProperties"} +} + +func (k *MinProperties) LocalizedString(p *message.Printer) string { + return p.Sprintf("minProperties: got %d, want %d", k.Got, k.Want) +} + +// -- + +type MaxProperties struct { + Got, Want int +} + +func (*MaxProperties) KeywordPath() []string { + return []string{"maxProperties"} +} + +func (k *MaxProperties) LocalizedString(p *message.Printer) string { + return p.Sprintf("maxProperties: got %d, want %d", k.Got, k.Want) +} + +// -- + +type MinItems struct { + Got, Want int +} + +func (*MinItems) KeywordPath() []string { + return []string{"minItems"} +} + +func (k *MinItems) LocalizedString(p *message.Printer) string { + return p.Sprintf("minItems: got %d, want %d", k.Got, k.Want) +} + +// -- + +type MaxItems struct { + Got, Want int +} + +func (*MaxItems) KeywordPath() []string { + return []string{"maxItems"} +} + +func (k *MaxItems) LocalizedString(p *message.Printer) string { + return p.Sprintf("maxItems: got %d, want %d", k.Got, k.Want) +} + +// -- + +type AdditionalItems struct { + Count int +} + +func (*AdditionalItems) KeywordPath() []string { + return []string{"additionalItems"} +} + +func (k *AdditionalItems) LocalizedString(p *message.Printer) string { + return p.Sprintf("last %d additionalItem(s) not allowed", k.Count) +} + +// -- + +type Required struct { + Missing []string +} + +func (*Required) KeywordPath() []string { + return []string{"required"} +} + +func (k *Required) LocalizedString(p *message.Printer) string { + if len(k.Missing) == 1 { + return p.Sprintf("missing property %s", quote(k.Missing[0])) + } + return p.Sprintf("missing properties %s", joinQuoted(k.Missing, ", ")) +} + +// -- + +type Dependency struct { + Prop string // dependency of prop that failed + Missing []string // missing props +} + +func (k *Dependency) KeywordPath() []string { + return []string{"dependency", k.Prop} +} + +func (k *Dependency) LocalizedString(p *message.Printer) string { + return p.Sprintf("properties %s required, if %s exists", joinQuoted(k.Missing, ", "), quote(k.Prop)) +} + +// -- + +type DependentRequired struct { + Prop string // dependency of prop that failed + Missing []string // missing props +} + +func (k *DependentRequired) KeywordPath() []string { + return []string{"dependentRequired", k.Prop} +} + +func (k *DependentRequired) LocalizedString(p *message.Printer) string { + return p.Sprintf("properties %s required, if %s exists", joinQuoted(k.Missing, ", "), quote(k.Prop)) +} + +// -- + +type AdditionalProperties struct { + Properties []string +} + +func (*AdditionalProperties) KeywordPath() []string { + return []string{"additionalProperties"} +} + +func (k *AdditionalProperties) LocalizedString(p *message.Printer) string { + return p.Sprintf("additional properties %s not allowed", joinQuoted(k.Properties, ", ")) +} + +// -- + +type PropertyNames struct { + Property string +} + +func (*PropertyNames) KeywordPath() []string { + return []string{"propertyNames"} +} + +func (k *PropertyNames) LocalizedString(p *message.Printer) string { + return p.Sprintf("invalid propertyName %s", quote(k.Property)) +} + +// -- + +type UniqueItems struct { + Duplicates [2]int +} + +func (*UniqueItems) KeywordPath() []string { + return []string{"uniqueItems"} +} + +func (k *UniqueItems) LocalizedString(p *message.Printer) string { + return p.Sprintf("items at %d and %d are equal", k.Duplicates[0], k.Duplicates[1]) +} + +// -- + +type Contains struct{} + +func (*Contains) KeywordPath() []string { + return []string{"contains"} +} + +func (*Contains) LocalizedString(p *message.Printer) string { + return p.Sprintf("no items match contains schema") +} + +// -- + +type MinContains struct { + Got []int + Want int +} + +func (*MinContains) KeywordPath() []string { + return []string{"minContains"} +} + +func (k *MinContains) LocalizedString(p *message.Printer) string { + if len(k.Got) == 0 { + return p.Sprintf("min %d items required to match contains schema, but none matched", k.Want) + } else { + got := fmt.Sprintf("%v", k.Got) + return p.Sprintf("min %d items required to match contains schema, but matched %d items at %v", k.Want, len(k.Got), got[1:len(got)-1]) + } +} + +// -- + +type MaxContains struct { + Got []int + Want int +} + +func (*MaxContains) KeywordPath() []string { + return []string{"maxContains"} +} + +func (k *MaxContains) LocalizedString(p *message.Printer) string { + got := fmt.Sprintf("%v", k.Got) + return p.Sprintf("max %d items required to match contains schema, but matched %d items at %v", k.Want, len(k.Got), got[1:len(got)-1]) +} + +// -- + +type MinLength struct { + Got, Want int +} + +func (*MinLength) KeywordPath() []string { + return []string{"minLength"} +} + +func (k *MinLength) LocalizedString(p *message.Printer) string { + return p.Sprintf("minLength: got %d, want %d", k.Got, k.Want) +} + +// -- + +type MaxLength struct { + Got, Want int +} + +func (*MaxLength) KeywordPath() []string { + return []string{"maxLength"} +} + +func (k *MaxLength) LocalizedString(p *message.Printer) string { + return p.Sprintf("maxLength: got %d, want %d", k.Got, k.Want) +} + +// -- + +type Pattern struct { + Got string + Want string +} + +func (*Pattern) KeywordPath() []string { + return []string{"pattern"} +} + +func (k *Pattern) LocalizedString(p *message.Printer) string { + return p.Sprintf("%s does not match pattern %s", quote(k.Got), quote(k.Want)) +} + +// -- + +type ContentEncoding struct { + Want string + Err error +} + +func (*ContentEncoding) KeywordPath() []string { + return []string{"contentEncoding"} +} + +func (k *ContentEncoding) LocalizedString(p *message.Printer) string { + return p.Sprintf("value is not %s encoded: %v", quote(k.Want), localizedError(k.Err, p)) +} + +// -- + +type ContentMediaType struct { + Got []byte + Want string + Err error +} + +func (*ContentMediaType) KeywordPath() []string { + return []string{"contentMediaType"} +} + +func (k *ContentMediaType) LocalizedString(p *message.Printer) string { + return p.Sprintf("value if not of mediatype %s: %v", quote(k.Want), k.Err) +} + +// -- + +type ContentSchema struct{} + +func (*ContentSchema) KeywordPath() []string { + return []string{"contentSchema"} +} + +func (*ContentSchema) LocalizedString(p *message.Printer) string { + return p.Sprintf("'contentSchema' failed") +} + +// -- + +type Minimum struct { + Got *big.Rat + Want *big.Rat +} + +func (*Minimum) KeywordPath() []string { + return []string{"minimum"} +} + +func (k *Minimum) LocalizedString(p *message.Printer) string { + got, _ := k.Got.Float64() + want, _ := k.Want.Float64() + return p.Sprintf("minimum: got %v, want %v", got, want) +} + +// -- + +type Maximum struct { + Got *big.Rat + Want *big.Rat +} + +func (*Maximum) KeywordPath() []string { + return []string{"maximum"} +} + +func (k *Maximum) LocalizedString(p *message.Printer) string { + got, _ := k.Got.Float64() + want, _ := k.Want.Float64() + return p.Sprintf("maximum: got %v, want %v", got, want) +} + +// -- + +type ExclusiveMinimum struct { + Got *big.Rat + Want *big.Rat +} + +func (*ExclusiveMinimum) KeywordPath() []string { + return []string{"exclusiveMinimum"} +} + +func (k *ExclusiveMinimum) LocalizedString(p *message.Printer) string { + got, _ := k.Got.Float64() + want, _ := k.Want.Float64() + return p.Sprintf("exclusiveMinimum: got %v, want %v", got, want) +} + +// -- + +type ExclusiveMaximum struct { + Got *big.Rat + Want *big.Rat +} + +func (*ExclusiveMaximum) KeywordPath() []string { + return []string{"exclusiveMaximum"} +} + +func (k *ExclusiveMaximum) LocalizedString(p *message.Printer) string { + got, _ := k.Got.Float64() + want, _ := k.Want.Float64() + return p.Sprintf("exclusiveMaximum: got %v, want %v", got, want) +} + +// -- + +type MultipleOf struct { + Got *big.Rat + Want *big.Rat +} + +func (*MultipleOf) KeywordPath() []string { + return []string{"multipleOf"} +} + +func (k *MultipleOf) LocalizedString(p *message.Printer) string { + got, _ := k.Got.Float64() + want, _ := k.Want.Float64() + return p.Sprintf("multipleOf: got %v, want %v", got, want) +} + +// -- + +func quote(s string) string { + s = fmt.Sprintf("%q", s) + s = strings.ReplaceAll(s, `\"`, `"`) + s = strings.ReplaceAll(s, `'`, `\'`) + return "'" + s[1:len(s)-1] + "'" +} + +func joinQuoted(arr []string, sep string) string { + var sb strings.Builder + for _, s := range arr { + if sb.Len() > 0 { + sb.WriteString(sep) + } + sb.WriteString(quote(s)) + } + return sb.String() +} + +// to be used only for primitive. +func display(v any) string { + switch v := v.(type) { + case string: + return quote(v) + case []any, map[string]any: + return "value" + default: + return fmt.Sprintf("%v", v) + } +} + +func localizedError(err error, p *message.Printer) string { + if err, ok := err.(interface{ LocalizedError(*message.Printer) string }); ok { + return err.LocalizedError(p) + } + return err.Error() +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/loader.go b/vendor/github.com/santhosh-tekuri/jsonschema/v6/loader.go new file mode 100644 index 0000000..ce0170e --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/loader.go @@ -0,0 +1,266 @@ +package jsonschema + +import ( + "embed" + "encoding/json" + "errors" + "fmt" + "io" + "io/fs" + gourl "net/url" + "os" + "path/filepath" + "runtime" + "strings" +) + +// URLLoader knows how to load json from given url. +type URLLoader interface { + // Load loads json from given absolute url. + Load(url string) (any, error) +} + +// -- + +// FileLoader loads json file url. +type FileLoader struct{} + +func (l FileLoader) Load(url string) (any, error) { + path, err := l.ToFile(url) + if err != nil { + return nil, err + } + f, err := os.Open(path) + if err != nil { + return nil, err + } + defer f.Close() + return UnmarshalJSON(f) +} + +// ToFile is helper method to convert file url to file path. +func (l FileLoader) ToFile(url string) (string, error) { + u, err := gourl.Parse(url) + if err != nil { + return "", err + } + if u.Scheme != "file" { + return "", fmt.Errorf("invalid file url: %s", u) + } + path := u.Path + if runtime.GOOS == "windows" { + path = strings.TrimPrefix(path, "/") + path = filepath.FromSlash(path) + } + return path, nil +} + +// -- + +// SchemeURLLoader delegates to other [URLLoaders] +// based on url scheme. +type SchemeURLLoader map[string]URLLoader + +func (l SchemeURLLoader) Load(url string) (any, error) { + u, err := gourl.Parse(url) + if err != nil { + return nil, err + } + ll, ok := l[u.Scheme] + if !ok { + return nil, &UnsupportedURLSchemeError{u.String()} + } + return ll.Load(url) +} + +// -- + +//go:embed metaschemas +var metaFS embed.FS + +func openMeta(url string) (fs.File, error) { + u, meta := strings.CutPrefix(url, "http://json-schema.org/") + if !meta { + u, meta = strings.CutPrefix(url, "https://json-schema.org/") + } + if meta { + if u == "schema" { + return openMeta(draftLatest.url) + } + f, err := metaFS.Open("metaschemas/" + u) + if err != nil { + if errors.Is(err, fs.ErrNotExist) { + return nil, nil + } + return nil, err + } + return f, err + } + return nil, nil + +} + +func isMeta(url string) bool { + f, err := openMeta(url) + if err != nil { + return true + } + if f != nil { + f.Close() + return true + } + return false +} + +func loadMeta(url string) (any, error) { + f, err := openMeta(url) + if err != nil { + return nil, err + } + if f == nil { + return nil, nil + } + defer f.Close() + return UnmarshalJSON(f) +} + +// -- + +type defaultLoader struct { + docs map[url]any // docs loaded so far + loader URLLoader +} + +func (l *defaultLoader) add(url url, doc any) bool { + if _, ok := l.docs[url]; ok { + return false + } + l.docs[url] = doc + return true +} + +func (l *defaultLoader) load(url url) (any, error) { + if doc, ok := l.docs[url]; ok { + return doc, nil + } + doc, err := loadMeta(url.String()) + if err != nil { + return nil, err + } + if doc != nil { + l.add(url, doc) + return doc, nil + } + if l.loader == nil { + return nil, &LoadURLError{url.String(), errors.New("no URLLoader set")} + } + doc, err = l.loader.Load(url.String()) + if err != nil { + return nil, &LoadURLError{URL: url.String(), Err: err} + } + l.add(url, doc) + return doc, nil +} + +func (l *defaultLoader) getDraft(up urlPtr, doc any, defaultDraft *Draft, cycle map[url]struct{}) (*Draft, error) { + obj, ok := doc.(map[string]any) + if !ok { + return defaultDraft, nil + } + sch, ok := strVal(obj, "$schema") + if !ok { + return defaultDraft, nil + } + if draft := draftFromURL(sch); draft != nil { + return draft, nil + } + sch, _ = split(sch) + if _, err := gourl.Parse(sch); err != nil { + return nil, &InvalidMetaSchemaURLError{up.String(), err} + } + schUrl := url(sch) + if up.ptr.isEmpty() && schUrl == up.url { + return nil, &UnsupportedDraftError{schUrl.String()} + } + if _, ok := cycle[schUrl]; ok { + return nil, &MetaSchemaCycleError{schUrl.String()} + } + cycle[schUrl] = struct{}{} + doc, err := l.load(schUrl) + if err != nil { + return nil, err + } + return l.getDraft(urlPtr{schUrl, ""}, doc, defaultDraft, cycle) +} + +func (l *defaultLoader) getMetaVocabs(doc any, draft *Draft, vocabularies map[string]*Vocabulary) ([]string, error) { + obj, ok := doc.(map[string]any) + if !ok { + return nil, nil + } + sch, ok := strVal(obj, "$schema") + if !ok { + return nil, nil + } + if draft := draftFromURL(sch); draft != nil { + return nil, nil + } + sch, _ = split(sch) + if _, err := gourl.Parse(sch); err != nil { + return nil, &ParseURLError{sch, err} + } + schUrl := url(sch) + doc, err := l.load(schUrl) + if err != nil { + return nil, err + } + return draft.getVocabs(schUrl, doc, vocabularies) +} + +// -- + +type LoadURLError struct { + URL string + Err error +} + +func (e *LoadURLError) Error() string { + return fmt.Sprintf("failing loading %q: %v", e.URL, e.Err) +} + +// -- + +type UnsupportedURLSchemeError struct { + url string +} + +func (e *UnsupportedURLSchemeError) Error() string { + return fmt.Sprintf("no URLLoader registered for %q", e.url) +} + +// -- + +type ResourceExistsError struct { + url string +} + +func (e *ResourceExistsError) Error() string { + return fmt.Sprintf("resource for %q already exists", e.url) +} + +// -- + +// UnmarshalJSON unmarshals into [any] without losing +// number precision using [json.Number]. +func UnmarshalJSON(r io.Reader) (any, error) { + decoder := json.NewDecoder(r) + decoder.UseNumber() + var doc any + if err := decoder.Decode(&doc); err != nil { + return nil, err + } + if _, err := decoder.Token(); err == nil || err != io.EOF { + return nil, fmt.Errorf("invalid character after top-level value") + } + return doc, nil +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft-04/schema b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft-04/schema new file mode 100644 index 0000000..b2a7ff0 --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft-04/schema @@ -0,0 +1,151 @@ +{ + "$schema": "http://json-schema.org/draft-04/schema#", + "description": "Core schema meta-schema", + "definitions": { + "schemaArray": { + "type": "array", + "minItems": 1, + "items": { "$ref": "#" } + }, + "positiveInteger": { + "type": "integer", + "minimum": 0 + }, + "positiveIntegerDefault0": { + "allOf": [ { "$ref": "#/definitions/positiveInteger" }, { "default": 0 } ] + }, + "simpleTypes": { + "enum": [ "array", "boolean", "integer", "null", "number", "object", "string" ] + }, + "stringArray": { + "type": "array", + "items": { "type": "string" }, + "minItems": 1, + "uniqueItems": true + } + }, + "type": "object", + "properties": { + "id": { + "type": "string", + "format": "uriref" + }, + "$schema": { + "type": "string", + "format": "uri" + }, + "title": { + "type": "string" + }, + "description": { + "type": "string" + }, + "default": {}, + "multipleOf": { + "type": "number", + "minimum": 0, + "exclusiveMinimum": true + }, + "maximum": { + "type": "number" + }, + "exclusiveMaximum": { + "type": "boolean", + "default": false + }, + "minimum": { + "type": "number" + }, + "exclusiveMinimum": { + "type": "boolean", + "default": false + }, + "maxLength": { "$ref": "#/definitions/positiveInteger" }, + "minLength": { "$ref": "#/definitions/positiveIntegerDefault0" }, + "pattern": { + "type": "string", + "format": "regex" + }, + "additionalItems": { + "anyOf": [ + { "type": "boolean" }, + { "$ref": "#" } + ], + "default": {} + }, + "items": { + "anyOf": [ + { "$ref": "#" }, + { "$ref": "#/definitions/schemaArray" } + ], + "default": {} + }, + "maxItems": { "$ref": "#/definitions/positiveInteger" }, + "minItems": { "$ref": "#/definitions/positiveIntegerDefault0" }, + "uniqueItems": { + "type": "boolean", + "default": false + }, + "maxProperties": { "$ref": "#/definitions/positiveInteger" }, + "minProperties": { "$ref": "#/definitions/positiveIntegerDefault0" }, + "required": { "$ref": "#/definitions/stringArray" }, + "additionalProperties": { + "anyOf": [ + { "type": "boolean" }, + { "$ref": "#" } + ], + "default": {} + }, + "definitions": { + "type": "object", + "additionalProperties": { "$ref": "#" }, + "default": {} + }, + "properties": { + "type": "object", + "additionalProperties": { "$ref": "#" }, + "default": {} + }, + "patternProperties": { + "type": "object", + "additionalProperties": { "$ref": "#" }, + "default": {} + }, + "dependencies": { + "type": "object", + "additionalProperties": { + "anyOf": [ + { "$ref": "#" }, + { "$ref": "#/definitions/stringArray" } + ] + } + }, + "enum": { + "type": "array", + "minItems": 1, + "uniqueItems": true + }, + "type": { + "anyOf": [ + { "$ref": "#/definitions/simpleTypes" }, + { + "type": "array", + "items": { "$ref": "#/definitions/simpleTypes" }, + "minItems": 1, + "uniqueItems": true + } + ] + }, + "allOf": { "$ref": "#/definitions/schemaArray" }, + "anyOf": { "$ref": "#/definitions/schemaArray" }, + "oneOf": { "$ref": "#/definitions/schemaArray" }, + "not": { "$ref": "#" }, + "format": { "type": "string" }, + "$ref": { "type": "string" } + }, + "dependencies": { + "exclusiveMaximum": [ "maximum" ], + "exclusiveMinimum": [ "minimum" ] + }, + "default": {} +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft-06/schema b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft-06/schema new file mode 100644 index 0000000..fa22ad1 --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft-06/schema @@ -0,0 +1,150 @@ +{ + "$schema": "http://json-schema.org/draft-06/schema#", + "$id": "http://json-schema.org/draft-06/schema#", + "title": "Core schema meta-schema", + "definitions": { + "schemaArray": { + "type": "array", + "minItems": 1, + "items": { "$ref": "#" } + }, + "nonNegativeInteger": { + "type": "integer", + "minimum": 0 + }, + "nonNegativeIntegerDefault0": { + "allOf": [ + { "$ref": "#/definitions/nonNegativeInteger" }, + { "default": 0 } + ] + }, + "simpleTypes": { + "enum": [ + "array", + "boolean", + "integer", + "null", + "number", + "object", + "string" + ] + }, + "stringArray": { + "type": "array", + "items": { "type": "string" }, + "uniqueItems": true, + "default": [] + } + }, + "type": ["object", "boolean"], + "properties": { + "$id": { + "type": "string", + "format": "uri-reference" + }, + "$schema": { + "type": "string", + "format": "uri" + }, + "$ref": { + "type": "string", + "format": "uri-reference" + }, + "title": { + "type": "string" + }, + "description": { + "type": "string" + }, + "default": {}, + "multipleOf": { + "type": "number", + "exclusiveMinimum": 0 + }, + "maximum": { + "type": "number" + }, + "exclusiveMaximum": { + "type": "number" + }, + "minimum": { + "type": "number" + }, + "exclusiveMinimum": { + "type": "number" + }, + "maxLength": { "$ref": "#/definitions/nonNegativeInteger" }, + "minLength": { "$ref": "#/definitions/nonNegativeIntegerDefault0" }, + "pattern": { + "type": "string", + "format": "regex" + }, + "additionalItems": { "$ref": "#" }, + "items": { + "anyOf": [ + { "$ref": "#" }, + { "$ref": "#/definitions/schemaArray" } + ], + "default": {} + }, + "maxItems": { "$ref": "#/definitions/nonNegativeInteger" }, + "minItems": { "$ref": "#/definitions/nonNegativeIntegerDefault0" }, + "uniqueItems": { + "type": "boolean", + "default": false + }, + "contains": { "$ref": "#" }, + "maxProperties": { "$ref": "#/definitions/nonNegativeInteger" }, + "minProperties": { "$ref": "#/definitions/nonNegativeIntegerDefault0" }, + "required": { "$ref": "#/definitions/stringArray" }, + "additionalProperties": { "$ref": "#" }, + "definitions": { + "type": "object", + "additionalProperties": { "$ref": "#" }, + "default": {} + }, + "properties": { + "type": "object", + "additionalProperties": { "$ref": "#" }, + "default": {} + }, + "patternProperties": { + "type": "object", + "additionalProperties": { "$ref": "#" }, + "default": {} + }, + "dependencies": { + "type": "object", + "additionalProperties": { + "anyOf": [ + { "$ref": "#" }, + { "$ref": "#/definitions/stringArray" } + ] + } + }, + "propertyNames": { "$ref": "#" }, + "const": {}, + "enum": { + "type": "array", + "minItems": 1, + "uniqueItems": true + }, + "type": { + "anyOf": [ + { "$ref": "#/definitions/simpleTypes" }, + { + "type": "array", + "items": { "$ref": "#/definitions/simpleTypes" }, + "minItems": 1, + "uniqueItems": true + } + ] + }, + "format": { "type": "string" }, + "allOf": { "$ref": "#/definitions/schemaArray" }, + "anyOf": { "$ref": "#/definitions/schemaArray" }, + "oneOf": { "$ref": "#/definitions/schemaArray" }, + "not": { "$ref": "#" } + }, + "default": {} +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft-07/schema b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft-07/schema new file mode 100644 index 0000000..326759a --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft-07/schema @@ -0,0 +1,172 @@ +{ + "$schema": "http://json-schema.org/draft-07/schema#", + "$id": "http://json-schema.org/draft-07/schema#", + "title": "Core schema meta-schema", + "definitions": { + "schemaArray": { + "type": "array", + "minItems": 1, + "items": { "$ref": "#" } + }, + "nonNegativeInteger": { + "type": "integer", + "minimum": 0 + }, + "nonNegativeIntegerDefault0": { + "allOf": [ + { "$ref": "#/definitions/nonNegativeInteger" }, + { "default": 0 } + ] + }, + "simpleTypes": { + "enum": [ + "array", + "boolean", + "integer", + "null", + "number", + "object", + "string" + ] + }, + "stringArray": { + "type": "array", + "items": { "type": "string" }, + "uniqueItems": true, + "default": [] + } + }, + "type": ["object", "boolean"], + "properties": { + "$id": { + "type": "string", + "format": "uri-reference" + }, + "$schema": { + "type": "string", + "format": "uri" + }, + "$ref": { + "type": "string", + "format": "uri-reference" + }, + "$comment": { + "type": "string" + }, + "title": { + "type": "string" + }, + "description": { + "type": "string" + }, + "default": true, + "readOnly": { + "type": "boolean", + "default": false + }, + "writeOnly": { + "type": "boolean", + "default": false + }, + "examples": { + "type": "array", + "items": true + }, + "multipleOf": { + "type": "number", + "exclusiveMinimum": 0 + }, + "maximum": { + "type": "number" + }, + "exclusiveMaximum": { + "type": "number" + }, + "minimum": { + "type": "number" + }, + "exclusiveMinimum": { + "type": "number" + }, + "maxLength": { "$ref": "#/definitions/nonNegativeInteger" }, + "minLength": { "$ref": "#/definitions/nonNegativeIntegerDefault0" }, + "pattern": { + "type": "string", + "format": "regex" + }, + "additionalItems": { "$ref": "#" }, + "items": { + "anyOf": [ + { "$ref": "#" }, + { "$ref": "#/definitions/schemaArray" } + ], + "default": true + }, + "maxItems": { "$ref": "#/definitions/nonNegativeInteger" }, + "minItems": { "$ref": "#/definitions/nonNegativeIntegerDefault0" }, + "uniqueItems": { + "type": "boolean", + "default": false + }, + "contains": { "$ref": "#" }, + "maxProperties": { "$ref": "#/definitions/nonNegativeInteger" }, + "minProperties": { "$ref": "#/definitions/nonNegativeIntegerDefault0" }, + "required": { "$ref": "#/definitions/stringArray" }, + "additionalProperties": { "$ref": "#" }, + "definitions": { + "type": "object", + "additionalProperties": { "$ref": "#" }, + "default": {} + }, + "properties": { + "type": "object", + "additionalProperties": { "$ref": "#" }, + "default": {} + }, + "patternProperties": { + "type": "object", + "additionalProperties": { "$ref": "#" }, + "propertyNames": { "format": "regex" }, + "default": {} + }, + "dependencies": { + "type": "object", + "additionalProperties": { + "anyOf": [ + { "$ref": "#" }, + { "$ref": "#/definitions/stringArray" } + ] + } + }, + "propertyNames": { "$ref": "#" }, + "const": true, + "enum": { + "type": "array", + "items": true, + "minItems": 1, + "uniqueItems": true + }, + "type": { + "anyOf": [ + { "$ref": "#/definitions/simpleTypes" }, + { + "type": "array", + "items": { "$ref": "#/definitions/simpleTypes" }, + "minItems": 1, + "uniqueItems": true + } + ] + }, + "format": { "type": "string" }, + "contentMediaType": { "type": "string" }, + "contentEncoding": { "type": "string" }, + "if": { "$ref": "#" }, + "then": { "$ref": "#" }, + "else": { "$ref": "#" }, + "allOf": { "$ref": "#/definitions/schemaArray" }, + "anyOf": { "$ref": "#/definitions/schemaArray" }, + "oneOf": { "$ref": "#/definitions/schemaArray" }, + "not": { "$ref": "#" } + }, + "default": true +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2019-09/meta/applicator b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2019-09/meta/applicator new file mode 100644 index 0000000..857d2d4 --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2019-09/meta/applicator @@ -0,0 +1,55 @@ +{ + "$schema": "https://json-schema.org/draft/2019-09/schema", + "$id": "https://json-schema.org/draft/2019-09/meta/applicator", + "$vocabulary": { + "https://json-schema.org/draft/2019-09/vocab/applicator": true + }, + "$recursiveAnchor": true, + "title": "Applicator vocabulary meta-schema", + "type": ["object", "boolean"], + "properties": { + "additionalItems": { "$recursiveRef": "#" }, + "unevaluatedItems": { "$recursiveRef": "#" }, + "items": { + "anyOf": [ + { "$recursiveRef": "#" }, + { "$ref": "#/$defs/schemaArray" } + ] + }, + "contains": { "$recursiveRef": "#" }, + "additionalProperties": { "$recursiveRef": "#" }, + "unevaluatedProperties": { "$recursiveRef": "#" }, + "properties": { + "type": "object", + "additionalProperties": { "$recursiveRef": "#" }, + "default": {} + }, + "patternProperties": { + "type": "object", + "additionalProperties": { "$recursiveRef": "#" }, + "propertyNames": { "format": "regex" }, + "default": {} + }, + "dependentSchemas": { + "type": "object", + "additionalProperties": { + "$recursiveRef": "#" + } + }, + "propertyNames": { "$recursiveRef": "#" }, + "if": { "$recursiveRef": "#" }, + "then": { "$recursiveRef": "#" }, + "else": { "$recursiveRef": "#" }, + "allOf": { "$ref": "#/$defs/schemaArray" }, + "anyOf": { "$ref": "#/$defs/schemaArray" }, + "oneOf": { "$ref": "#/$defs/schemaArray" }, + "not": { "$recursiveRef": "#" } + }, + "$defs": { + "schemaArray": { + "type": "array", + "minItems": 1, + "items": { "$recursiveRef": "#" } + } + } +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2019-09/meta/content b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2019-09/meta/content new file mode 100644 index 0000000..fa5d20b --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2019-09/meta/content @@ -0,0 +1,15 @@ +{ + "$schema": "https://json-schema.org/draft/2019-09/schema", + "$id": "https://json-schema.org/draft/2019-09/meta/content", + "$vocabulary": { + "https://json-schema.org/draft/2019-09/vocab/content": true + }, + "$recursiveAnchor": true, + "title": "Content vocabulary meta-schema", + "type": ["object", "boolean"], + "properties": { + "contentMediaType": { "type": "string" }, + "contentEncoding": { "type": "string" }, + "contentSchema": { "$recursiveRef": "#" } + } +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2019-09/meta/core b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2019-09/meta/core new file mode 100644 index 0000000..bf57319 --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2019-09/meta/core @@ -0,0 +1,56 @@ +{ + "$schema": "https://json-schema.org/draft/2019-09/schema", + "$id": "https://json-schema.org/draft/2019-09/meta/core", + "$vocabulary": { + "https://json-schema.org/draft/2019-09/vocab/core": true + }, + "$recursiveAnchor": true, + "title": "Core vocabulary meta-schema", + "type": ["object", "boolean"], + "properties": { + "$id": { + "type": "string", + "format": "uri-reference", + "$comment": "Non-empty fragments not allowed.", + "pattern": "^[^#]*#?$" + }, + "$schema": { + "type": "string", + "format": "uri" + }, + "$anchor": { + "type": "string", + "pattern": "^[A-Za-z][-A-Za-z0-9.:_]*$" + }, + "$ref": { + "type": "string", + "format": "uri-reference" + }, + "$recursiveRef": { + "type": "string", + "format": "uri-reference" + }, + "$recursiveAnchor": { + "type": "boolean", + "default": false + }, + "$vocabulary": { + "type": "object", + "propertyNames": { + "type": "string", + "format": "uri" + }, + "additionalProperties": { + "type": "boolean" + } + }, + "$comment": { + "type": "string" + }, + "$defs": { + "type": "object", + "additionalProperties": { "$recursiveRef": "#" }, + "default": {} + } + } +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2019-09/meta/format b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2019-09/meta/format new file mode 100644 index 0000000..fe553c2 --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2019-09/meta/format @@ -0,0 +1,13 @@ +{ + "$schema": "https://json-schema.org/draft/2019-09/schema", + "$id": "https://json-schema.org/draft/2019-09/meta/format", + "$vocabulary": { + "https://json-schema.org/draft/2019-09/vocab/format": true + }, + "$recursiveAnchor": true, + "title": "Format vocabulary meta-schema", + "type": ["object", "boolean"], + "properties": { + "format": { "type": "string" } + } +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2019-09/meta/meta-data b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2019-09/meta/meta-data new file mode 100644 index 0000000..5c95715 --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2019-09/meta/meta-data @@ -0,0 +1,35 @@ +{ + "$schema": "https://json-schema.org/draft/2019-09/schema", + "$id": "https://json-schema.org/draft/2019-09/meta/meta-data", + "$vocabulary": { + "https://json-schema.org/draft/2019-09/vocab/meta-data": true + }, + "$recursiveAnchor": true, + "title": "Meta-data vocabulary meta-schema", + "type": ["object", "boolean"], + "properties": { + "title": { + "type": "string" + }, + "description": { + "type": "string" + }, + "default": true, + "deprecated": { + "type": "boolean", + "default": false + }, + "readOnly": { + "type": "boolean", + "default": false + }, + "writeOnly": { + "type": "boolean", + "default": false + }, + "examples": { + "type": "array", + "items": true + } + } +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2019-09/meta/validation b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2019-09/meta/validation new file mode 100644 index 0000000..f3525e0 --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2019-09/meta/validation @@ -0,0 +1,97 @@ +{ + "$schema": "https://json-schema.org/draft/2019-09/schema", + "$id": "https://json-schema.org/draft/2019-09/meta/validation", + "$vocabulary": { + "https://json-schema.org/draft/2019-09/vocab/validation": true + }, + "$recursiveAnchor": true, + "title": "Validation vocabulary meta-schema", + "type": ["object", "boolean"], + "properties": { + "multipleOf": { + "type": "number", + "exclusiveMinimum": 0 + }, + "maximum": { + "type": "number" + }, + "exclusiveMaximum": { + "type": "number" + }, + "minimum": { + "type": "number" + }, + "exclusiveMinimum": { + "type": "number" + }, + "maxLength": { "$ref": "#/$defs/nonNegativeInteger" }, + "minLength": { "$ref": "#/$defs/nonNegativeIntegerDefault0" }, + "pattern": { + "type": "string", + "format": "regex" + }, + "maxItems": { "$ref": "#/$defs/nonNegativeInteger" }, + "minItems": { "$ref": "#/$defs/nonNegativeIntegerDefault0" }, + "uniqueItems": { + "type": "boolean", + "default": false + }, + "maxContains": { "$ref": "#/$defs/nonNegativeInteger" }, + "minContains": { + "$ref": "#/$defs/nonNegativeInteger", + "default": 1 + }, + "maxProperties": { "$ref": "#/$defs/nonNegativeInteger" }, + "minProperties": { "$ref": "#/$defs/nonNegativeIntegerDefault0" }, + "required": { "$ref": "#/$defs/stringArray" }, + "dependentRequired": { + "type": "object", + "additionalProperties": { + "$ref": "#/$defs/stringArray" + } + }, + "const": true, + "enum": { + "type": "array", + "items": true + }, + "type": { + "anyOf": [ + { "$ref": "#/$defs/simpleTypes" }, + { + "type": "array", + "items": { "$ref": "#/$defs/simpleTypes" }, + "minItems": 1, + "uniqueItems": true + } + ] + } + }, + "$defs": { + "nonNegativeInteger": { + "type": "integer", + "minimum": 0 + }, + "nonNegativeIntegerDefault0": { + "$ref": "#/$defs/nonNegativeInteger", + "default": 0 + }, + "simpleTypes": { + "enum": [ + "array", + "boolean", + "integer", + "null", + "number", + "object", + "string" + ] + }, + "stringArray": { + "type": "array", + "items": { "type": "string" }, + "uniqueItems": true, + "default": [] + } + } +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2019-09/schema b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2019-09/schema new file mode 100644 index 0000000..f433389 --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2019-09/schema @@ -0,0 +1,41 @@ +{ + "$schema": "https://json-schema.org/draft/2019-09/schema", + "$id": "https://json-schema.org/draft/2019-09/schema", + "$vocabulary": { + "https://json-schema.org/draft/2019-09/vocab/core": true, + "https://json-schema.org/draft/2019-09/vocab/applicator": true, + "https://json-schema.org/draft/2019-09/vocab/validation": true, + "https://json-schema.org/draft/2019-09/vocab/meta-data": true, + "https://json-schema.org/draft/2019-09/vocab/format": false, + "https://json-schema.org/draft/2019-09/vocab/content": true + }, + "$recursiveAnchor": true, + "title": "Core and Validation specifications meta-schema", + "allOf": [ + {"$ref": "meta/core"}, + {"$ref": "meta/applicator"}, + {"$ref": "meta/validation"}, + {"$ref": "meta/meta-data"}, + {"$ref": "meta/format"}, + {"$ref": "meta/content"} + ], + "type": ["object", "boolean"], + "properties": { + "definitions": { + "$comment": "While no longer an official keyword as it is replaced by $defs, this keyword is retained in the meta-schema to prevent incompatible extensions as it remains in common use.", + "type": "object", + "additionalProperties": { "$recursiveRef": "#" }, + "default": {} + }, + "dependencies": { + "$comment": "\"dependencies\" is no longer a keyword, but schema authors should avoid redefining it to facilitate a smooth transition to \"dependentSchemas\" and \"dependentRequired\"", + "type": "object", + "additionalProperties": { + "anyOf": [ + { "$recursiveRef": "#" }, + { "$ref": "meta/validation#/$defs/stringArray" } + ] + } + } + } +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2020-12/meta/applicator b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2020-12/meta/applicator new file mode 100644 index 0000000..0ef24ed --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2020-12/meta/applicator @@ -0,0 +1,47 @@ +{ + "$schema": "https://json-schema.org/draft/2020-12/schema", + "$id": "https://json-schema.org/draft/2020-12/meta/applicator", + "$vocabulary": { + "https://json-schema.org/draft/2020-12/vocab/applicator": true + }, + "$dynamicAnchor": "meta", + "title": "Applicator vocabulary meta-schema", + "type": ["object", "boolean"], + "properties": { + "prefixItems": { "$ref": "#/$defs/schemaArray" }, + "items": { "$dynamicRef": "#meta" }, + "contains": { "$dynamicRef": "#meta" }, + "additionalProperties": { "$dynamicRef": "#meta" }, + "properties": { + "type": "object", + "additionalProperties": { "$dynamicRef": "#meta" }, + "default": {} + }, + "patternProperties": { + "type": "object", + "additionalProperties": { "$dynamicRef": "#meta" }, + "propertyNames": { "format": "regex" }, + "default": {} + }, + "dependentSchemas": { + "type": "object", + "additionalProperties": { "$dynamicRef": "#meta" }, + "default": {} + }, + "propertyNames": { "$dynamicRef": "#meta" }, + "if": { "$dynamicRef": "#meta" }, + "then": { "$dynamicRef": "#meta" }, + "else": { "$dynamicRef": "#meta" }, + "allOf": { "$ref": "#/$defs/schemaArray" }, + "anyOf": { "$ref": "#/$defs/schemaArray" }, + "oneOf": { "$ref": "#/$defs/schemaArray" }, + "not": { "$dynamicRef": "#meta" } + }, + "$defs": { + "schemaArray": { + "type": "array", + "minItems": 1, + "items": { "$dynamicRef": "#meta" } + } + } +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2020-12/meta/content b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2020-12/meta/content new file mode 100644 index 0000000..0330ff0 --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2020-12/meta/content @@ -0,0 +1,15 @@ +{ + "$schema": "https://json-schema.org/draft/2020-12/schema", + "$id": "https://json-schema.org/draft/2020-12/meta/content", + "$vocabulary": { + "https://json-schema.org/draft/2020-12/vocab/content": true + }, + "$dynamicAnchor": "meta", + "title": "Content vocabulary meta-schema", + "type": ["object", "boolean"], + "properties": { + "contentEncoding": { "type": "string" }, + "contentMediaType": { "type": "string" }, + "contentSchema": { "$dynamicRef": "#meta" } + } +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2020-12/meta/core b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2020-12/meta/core new file mode 100644 index 0000000..c4de700 --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2020-12/meta/core @@ -0,0 +1,50 @@ +{ + "$schema": "https://json-schema.org/draft/2020-12/schema", + "$id": "https://json-schema.org/draft/2020-12/meta/core", + "$vocabulary": { + "https://json-schema.org/draft/2020-12/vocab/core": true + }, + "$dynamicAnchor": "meta", + "title": "Core vocabulary meta-schema", + "type": ["object", "boolean"], + "properties": { + "$id": { + "$ref": "#/$defs/uriReferenceString", + "$comment": "Non-empty fragments not allowed.", + "pattern": "^[^#]*#?$" + }, + "$schema": { "$ref": "#/$defs/uriString" }, + "$ref": { "$ref": "#/$defs/uriReferenceString" }, + "$anchor": { "$ref": "#/$defs/anchorString" }, + "$dynamicRef": { "$ref": "#/$defs/uriReferenceString" }, + "$dynamicAnchor": { "$ref": "#/$defs/anchorString" }, + "$vocabulary": { + "type": "object", + "propertyNames": { "$ref": "#/$defs/uriString" }, + "additionalProperties": { + "type": "boolean" + } + }, + "$comment": { + "type": "string" + }, + "$defs": { + "type": "object", + "additionalProperties": { "$dynamicRef": "#meta" } + } + }, + "$defs": { + "anchorString": { + "type": "string", + "pattern": "^[A-Za-z_][-A-Za-z0-9._]*$" + }, + "uriString": { + "type": "string", + "format": "uri" + }, + "uriReferenceString": { + "type": "string", + "format": "uri-reference" + } + } +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2020-12/meta/format-annotation b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2020-12/meta/format-annotation new file mode 100644 index 0000000..0aa07d1 --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2020-12/meta/format-annotation @@ -0,0 +1,13 @@ +{ + "$schema": "https://json-schema.org/draft/2020-12/schema", + "$id": "https://json-schema.org/draft/2020-12/meta/format-annotation", + "$vocabulary": { + "https://json-schema.org/draft/2020-12/vocab/format-annotation": true + }, + "$dynamicAnchor": "meta", + "title": "Format vocabulary meta-schema for annotation results", + "type": ["object", "boolean"], + "properties": { + "format": { "type": "string" } + } +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2020-12/meta/format-assertion b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2020-12/meta/format-assertion new file mode 100644 index 0000000..38613bf --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2020-12/meta/format-assertion @@ -0,0 +1,13 @@ +{ + "$schema": "https://json-schema.org/draft/2020-12/schema", + "$id": "https://json-schema.org/draft/2020-12/meta/format-assertion", + "$vocabulary": { + "https://json-schema.org/draft/2020-12/vocab/format-assertion": true + }, + "$dynamicAnchor": "meta", + "title": "Format vocabulary meta-schema for assertion results", + "type": ["object", "boolean"], + "properties": { + "format": { "type": "string" } + } +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2020-12/meta/meta-data b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2020-12/meta/meta-data new file mode 100644 index 0000000..30e2837 --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2020-12/meta/meta-data @@ -0,0 +1,35 @@ +{ + "$schema": "https://json-schema.org/draft/2020-12/schema", + "$id": "https://json-schema.org/draft/2020-12/meta/meta-data", + "$vocabulary": { + "https://json-schema.org/draft/2020-12/vocab/meta-data": true + }, + "$dynamicAnchor": "meta", + "title": "Meta-data vocabulary meta-schema", + "type": ["object", "boolean"], + "properties": { + "title": { + "type": "string" + }, + "description": { + "type": "string" + }, + "default": true, + "deprecated": { + "type": "boolean", + "default": false + }, + "readOnly": { + "type": "boolean", + "default": false + }, + "writeOnly": { + "type": "boolean", + "default": false + }, + "examples": { + "type": "array", + "items": true + } + } +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2020-12/meta/unevaluated b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2020-12/meta/unevaluated new file mode 100644 index 0000000..e9e093d --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2020-12/meta/unevaluated @@ -0,0 +1,14 @@ +{ + "$schema": "https://json-schema.org/draft/2020-12/schema", + "$id": "https://json-schema.org/draft/2020-12/meta/unevaluated", + "$vocabulary": { + "https://json-schema.org/draft/2020-12/vocab/unevaluated": true + }, + "$dynamicAnchor": "meta", + "title": "Unevaluated applicator vocabulary meta-schema", + "type": ["object", "boolean"], + "properties": { + "unevaluatedItems": { "$dynamicRef": "#meta" }, + "unevaluatedProperties": { "$dynamicRef": "#meta" } + } +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2020-12/meta/validation b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2020-12/meta/validation new file mode 100644 index 0000000..4e016ed --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2020-12/meta/validation @@ -0,0 +1,97 @@ +{ + "$schema": "https://json-schema.org/draft/2020-12/schema", + "$id": "https://json-schema.org/draft/2020-12/meta/validation", + "$vocabulary": { + "https://json-schema.org/draft/2020-12/vocab/validation": true + }, + "$dynamicAnchor": "meta", + "title": "Validation vocabulary meta-schema", + "type": ["object", "boolean"], + "properties": { + "type": { + "anyOf": [ + { "$ref": "#/$defs/simpleTypes" }, + { + "type": "array", + "items": { "$ref": "#/$defs/simpleTypes" }, + "minItems": 1, + "uniqueItems": true + } + ] + }, + "const": true, + "enum": { + "type": "array", + "items": true + }, + "multipleOf": { + "type": "number", + "exclusiveMinimum": 0 + }, + "maximum": { + "type": "number" + }, + "exclusiveMaximum": { + "type": "number" + }, + "minimum": { + "type": "number" + }, + "exclusiveMinimum": { + "type": "number" + }, + "maxLength": { "$ref": "#/$defs/nonNegativeInteger" }, + "minLength": { "$ref": "#/$defs/nonNegativeIntegerDefault0" }, + "pattern": { + "type": "string", + "format": "regex" + }, + "maxItems": { "$ref": "#/$defs/nonNegativeInteger" }, + "minItems": { "$ref": "#/$defs/nonNegativeIntegerDefault0" }, + "uniqueItems": { + "type": "boolean", + "default": false + }, + "maxContains": { "$ref": "#/$defs/nonNegativeInteger" }, + "minContains": { + "$ref": "#/$defs/nonNegativeInteger", + "default": 1 + }, + "maxProperties": { "$ref": "#/$defs/nonNegativeInteger" }, + "minProperties": { "$ref": "#/$defs/nonNegativeIntegerDefault0" }, + "required": { "$ref": "#/$defs/stringArray" }, + "dependentRequired": { + "type": "object", + "additionalProperties": { + "$ref": "#/$defs/stringArray" + } + } + }, + "$defs": { + "nonNegativeInteger": { + "type": "integer", + "minimum": 0 + }, + "nonNegativeIntegerDefault0": { + "$ref": "#/$defs/nonNegativeInteger", + "default": 0 + }, + "simpleTypes": { + "enum": [ + "array", + "boolean", + "integer", + "null", + "number", + "object", + "string" + ] + }, + "stringArray": { + "type": "array", + "items": { "type": "string" }, + "uniqueItems": true, + "default": [] + } + } +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2020-12/schema b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2020-12/schema new file mode 100644 index 0000000..364f8ad --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/metaschemas/draft/2020-12/schema @@ -0,0 +1,57 @@ +{ + "$schema": "https://json-schema.org/draft/2020-12/schema", + "$id": "https://json-schema.org/draft/2020-12/schema", + "$vocabulary": { + "https://json-schema.org/draft/2020-12/vocab/core": true, + "https://json-schema.org/draft/2020-12/vocab/applicator": true, + "https://json-schema.org/draft/2020-12/vocab/unevaluated": true, + "https://json-schema.org/draft/2020-12/vocab/validation": true, + "https://json-schema.org/draft/2020-12/vocab/meta-data": true, + "https://json-schema.org/draft/2020-12/vocab/format-annotation": true, + "https://json-schema.org/draft/2020-12/vocab/content": true + }, + "$dynamicAnchor": "meta", + "title": "Core and Validation specifications meta-schema", + "allOf": [ + {"$ref": "meta/core"}, + {"$ref": "meta/applicator"}, + {"$ref": "meta/unevaluated"}, + {"$ref": "meta/validation"}, + {"$ref": "meta/meta-data"}, + {"$ref": "meta/format-annotation"}, + {"$ref": "meta/content"} + ], + "type": ["object", "boolean"], + "$comment": "This meta-schema also defines keywords that have appeared in previous drafts in order to prevent incompatible extensions as they remain in common use.", + "properties": { + "definitions": { + "$comment": "\"definitions\" has been replaced by \"$defs\".", + "type": "object", + "additionalProperties": { "$dynamicRef": "#meta" }, + "deprecated": true, + "default": {} + }, + "dependencies": { + "$comment": "\"dependencies\" has been split and replaced by \"dependentSchemas\" and \"dependentRequired\" in order to serve their differing semantics.", + "type": "object", + "additionalProperties": { + "anyOf": [ + { "$dynamicRef": "#meta" }, + { "$ref": "meta/validation#/$defs/stringArray" } + ] + }, + "deprecated": true, + "default": {} + }, + "$recursiveAnchor": { + "$comment": "\"$recursiveAnchor\" has been replaced by \"$dynamicAnchor\".", + "$ref": "meta/core#/$defs/anchorString", + "deprecated": true + }, + "$recursiveRef": { + "$comment": "\"$recursiveRef\" has been replaced by \"$dynamicRef\".", + "$ref": "meta/core#/$defs/uriReferenceString", + "deprecated": true + } + } +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/objcompiler.go b/vendor/github.com/santhosh-tekuri/jsonschema/v6/objcompiler.go new file mode 100644 index 0000000..f1494b1 --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/objcompiler.go @@ -0,0 +1,549 @@ +package jsonschema + +import ( + "encoding/json" + "fmt" + "math/big" + "strconv" +) + +type objCompiler struct { + c *Compiler + obj map[string]any + up urlPtr + r *root + res *resource + q *queue +} + +func (c *objCompiler) compile(s *Schema) error { + // id -- + if id := c.res.dialect.draft.getID(c.obj); id != "" { + s.ID = id + } + + // anchor -- + if s.DraftVersion < 2019 { + // anchor is specified in id + id := c.string(c.res.dialect.draft.id) + if id != "" { + _, f := split(id) + if f != "" { + var err error + s.Anchor, err = decode(f) + if err != nil { + return &ParseAnchorError{URL: s.Location} + } + } + } + } else { + s.Anchor = c.string("$anchor") + } + + if err := c.compileDraft4(s); err != nil { + return err + } + if s.DraftVersion >= 6 { + if err := c.compileDraft6(s); err != nil { + return err + } + } + if s.DraftVersion >= 7 { + if err := c.compileDraft7(s); err != nil { + return err + } + } + if s.DraftVersion >= 2019 { + if err := c.compileDraft2019(s); err != nil { + return err + } + } + if s.DraftVersion >= 2020 { + if err := c.compileDraft2020(s); err != nil { + return err + } + } + + // vocabularies + vocabs := c.res.dialect.activeVocabs(c.c.roots.assertVocabs, c.c.roots.vocabularies) + for _, vocab := range vocabs { + v := c.c.roots.vocabularies[vocab] + if v == nil { + continue + } + ext, err := v.Compile(&CompilerContext{c}, c.obj) + if err != nil { + return err + } + if ext != nil { + s.Extensions = append(s.Extensions, ext) + } + } + + return nil +} + +func (c *objCompiler) compileDraft4(s *Schema) error { + var err error + + if c.hasVocab("core") { + if s.Ref, err = c.enqueueRef("$ref"); err != nil { + return err + } + if s.DraftVersion < 2019 && s.Ref != nil { + // All other properties in a "$ref" object MUST be ignored + return nil + } + } + + if c.hasVocab("applicator") { + s.AllOf = c.enqueueArr("allOf") + s.AnyOf = c.enqueueArr("anyOf") + s.OneOf = c.enqueueArr("oneOf") + s.Not = c.enqueueProp("not") + + if s.DraftVersion < 2020 { + if items, ok := c.obj["items"]; ok { + if _, ok := items.([]any); ok { + s.Items = c.enqueueArr("items") + s.AdditionalItems = c.enqueueAdditional("additionalItems") + } else { + s.Items = c.enqueueProp("items") + } + } + } + + s.Properties = c.enqueueMap("properties") + if m := c.enqueueMap("patternProperties"); m != nil { + s.PatternProperties = map[Regexp]*Schema{} + for pname, sch := range m { + re, err := c.c.roots.regexpEngine(pname) + if err != nil { + return &InvalidRegexError{c.up.format("patternProperties"), pname, err} + } + s.PatternProperties[re] = sch + } + } + s.AdditionalProperties = c.enqueueAdditional("additionalProperties") + + if m := c.objVal("dependencies"); m != nil { + s.Dependencies = map[string]any{} + for pname, pvalue := range m { + if arr, ok := pvalue.([]any); ok { + s.Dependencies[pname] = toStrings(arr) + } else { + ptr := c.up.ptr.append2("dependencies", pname) + s.Dependencies[pname] = c.enqueuePtr(ptr) + } + } + } + } + + if c.hasVocab("validation") { + if t, ok := c.obj["type"]; ok { + s.Types = newTypes(t) + } + if arr := c.arrVal("enum"); arr != nil { + s.Enum = newEnum(arr) + } + s.MultipleOf = c.numVal("multipleOf") + s.Maximum = c.numVal("maximum") + if c.boolean("exclusiveMaximum") { + s.ExclusiveMaximum = s.Maximum + s.Maximum = nil + } else { + s.ExclusiveMaximum = c.numVal("exclusiveMaximum") + } + s.Minimum = c.numVal("minimum") + if c.boolean("exclusiveMinimum") { + s.ExclusiveMinimum = s.Minimum + s.Minimum = nil + } else { + s.ExclusiveMinimum = c.numVal("exclusiveMinimum") + } + + s.MinLength = c.intVal("minLength") + s.MaxLength = c.intVal("maxLength") + if pat := c.strVal("pattern"); pat != nil { + s.Pattern, err = c.c.roots.regexpEngine(*pat) + if err != nil { + return &InvalidRegexError{c.up.format("pattern"), *pat, err} + } + } + + s.MinItems = c.intVal("minItems") + s.MaxItems = c.intVal("maxItems") + s.UniqueItems = c.boolean("uniqueItems") + + s.MaxProperties = c.intVal("maxProperties") + s.MinProperties = c.intVal("minProperties") + if arr := c.arrVal("required"); arr != nil { + s.Required = toStrings(arr) + } + } + + // format -- + if c.assertFormat(s.DraftVersion) { + if f := c.strVal("format"); f != nil { + if *f == "regex" { + s.Format = &Format{ + Name: "regex", + Validate: c.c.roots.regexpEngine.validate, + } + } else { + s.Format = c.c.formats[*f] + if s.Format == nil { + s.Format = formats[*f] + } + } + } + } + + // annotations -- + s.Title = c.string("title") + s.Description = c.string("description") + if v, ok := c.obj["default"]; ok { + s.Default = &v + } + + return nil +} + +func (c *objCompiler) compileDraft6(s *Schema) error { + if c.hasVocab("applicator") { + s.Contains = c.enqueueProp("contains") + s.PropertyNames = c.enqueueProp("propertyNames") + } + if c.hasVocab("validation") { + if v, ok := c.obj["const"]; ok { + s.Const = &v + } + } + return nil +} + +func (c *objCompiler) compileDraft7(s *Schema) error { + if c.hasVocab("applicator") { + s.If = c.enqueueProp("if") + if s.If != nil { + b := c.boolVal("if") + if b == nil || *b { + s.Then = c.enqueueProp("then") + } + if b == nil || !*b { + s.Else = c.enqueueProp("else") + } + } + } + + if c.c.assertContent { + if ce := c.strVal("contentEncoding"); ce != nil { + s.ContentEncoding = c.c.decoders[*ce] + if s.ContentEncoding == nil { + s.ContentEncoding = decoders[*ce] + } + } + if cm := c.strVal("contentMediaType"); cm != nil { + s.ContentMediaType = c.c.mediaTypes[*cm] + if s.ContentMediaType == nil { + s.ContentMediaType = mediaTypes[*cm] + } + } + } + + // annotations -- + s.Comment = c.string("$comment") + s.ReadOnly = c.boolean("readOnly") + s.WriteOnly = c.boolean("writeOnly") + if arr, ok := c.obj["examples"].([]any); ok { + s.Examples = arr + } + + return nil +} + +func (c *objCompiler) compileDraft2019(s *Schema) error { + var err error + + if c.hasVocab("core") { + if s.RecursiveRef, err = c.enqueueRef("$recursiveRef"); err != nil { + return err + } + s.RecursiveAnchor = c.boolean("$recursiveAnchor") + } + + if c.hasVocab("validation") { + if s.Contains != nil { + s.MinContains = c.intVal("minContains") + s.MaxContains = c.intVal("maxContains") + } + if m := c.objVal("dependentRequired"); m != nil { + s.DependentRequired = map[string][]string{} + for pname, pvalue := range m { + if arr, ok := pvalue.([]any); ok { + s.DependentRequired[pname] = toStrings(arr) + } + } + } + } + + if c.hasVocab("applicator") { + s.DependentSchemas = c.enqueueMap("dependentSchemas") + } + + var unevaluated bool + if s.DraftVersion == 2019 { + unevaluated = c.hasVocab("applicator") + } else { + unevaluated = c.hasVocab("unevaluated") + } + if unevaluated { + s.UnevaluatedItems = c.enqueueProp("unevaluatedItems") + s.UnevaluatedProperties = c.enqueueProp("unevaluatedProperties") + } + + if c.c.assertContent { + if s.ContentMediaType != nil && s.ContentMediaType.UnmarshalJSON != nil { + s.ContentSchema = c.enqueueProp("contentSchema") + } + } + + // annotations -- + s.Deprecated = c.boolean("deprecated") + + return nil +} + +func (c *objCompiler) compileDraft2020(s *Schema) error { + if c.hasVocab("core") { + sch, err := c.enqueueRef("$dynamicRef") + if err != nil { + return err + } + if sch != nil { + dref := c.strVal("$dynamicRef") + _, frag, err := splitFragment(*dref) + if err != nil { + return err + } + var anch string + if anchor, ok := frag.convert().(anchor); ok { + anch = string(anchor) + } + s.DynamicRef = &DynamicRef{sch, anch} + } + s.DynamicAnchor = c.string("$dynamicAnchor") + } + + if c.hasVocab("applicator") { + s.PrefixItems = c.enqueueArr("prefixItems") + s.Items2020 = c.enqueueProp("items") + } + + return nil +} + +// enqueue helpers -- + +func (c *objCompiler) enqueuePtr(ptr jsonPointer) *Schema { + up := urlPtr{c.up.url, ptr} + return c.c.enqueue(c.q, up) +} + +func (c *objCompiler) enqueueRef(pname string) (*Schema, error) { + ref := c.strVal(pname) + if ref == nil { + return nil, nil + } + baseURL := c.res.id + // baseURL := c.r.baseURL(c.up.ptr) + uf, err := baseURL.join(*ref) + if err != nil { + return nil, err + } + + up, err := c.r.resolve(*uf) + if err != nil { + return nil, err + } + if up != nil { + // local ref + return c.enqueuePtr(up.ptr), nil + } + + // remote ref + up_, err := c.c.roots.resolveFragment(*uf) + if err != nil { + return nil, err + } + return c.c.enqueue(c.q, up_), nil +} + +func (c *objCompiler) enqueueProp(pname string) *Schema { + if _, ok := c.obj[pname]; !ok { + return nil + } + ptr := c.up.ptr.append(pname) + return c.enqueuePtr(ptr) +} + +func (c *objCompiler) enqueueArr(pname string) []*Schema { + arr := c.arrVal(pname) + if arr == nil { + return nil + } + sch := make([]*Schema, len(arr)) + for i := range arr { + ptr := c.up.ptr.append2(pname, strconv.Itoa(i)) + sch[i] = c.enqueuePtr(ptr) + } + return sch +} + +func (c *objCompiler) enqueueMap(pname string) map[string]*Schema { + obj := c.objVal(pname) + if obj == nil { + return nil + } + sch := make(map[string]*Schema) + for k := range obj { + ptr := c.up.ptr.append2(pname, k) + sch[k] = c.enqueuePtr(ptr) + } + return sch +} + +func (c *objCompiler) enqueueAdditional(pname string) any { + if b := c.boolVal(pname); b != nil { + return *b + } + if sch := c.enqueueProp(pname); sch != nil { + return sch + } + return nil +} + +// -- + +func (c *objCompiler) hasVocab(name string) bool { + return c.res.dialect.hasVocab(name) +} + +func (c *objCompiler) assertFormat(draftVersion int) bool { + if c.c.assertFormat || draftVersion < 2019 { + return true + } + if draftVersion == 2019 { + return c.hasVocab("format") + } else { + return c.hasVocab("format-assertion") + } +} + +// value helpers -- + +func (c *objCompiler) boolVal(pname string) *bool { + v, ok := c.obj[pname] + if !ok { + return nil + } + b, ok := v.(bool) + if !ok { + return nil + } + return &b +} + +func (c *objCompiler) boolean(pname string) bool { + b := c.boolVal(pname) + return b != nil && *b +} + +func (c *objCompiler) strVal(pname string) *string { + v, ok := c.obj[pname] + if !ok { + return nil + } + s, ok := v.(string) + if !ok { + return nil + } + return &s +} + +func (c *objCompiler) string(pname string) string { + if s := c.strVal(pname); s != nil { + return *s + } + return "" +} + +func (c *objCompiler) numVal(pname string) *big.Rat { + v, ok := c.obj[pname] + if !ok { + return nil + } + switch v.(type) { + case json.Number, float32, float64, int, int8, int16, int32, int64, uint, uint8, uint16, uint32, uint64: + if n, ok := new(big.Rat).SetString(fmt.Sprint(v)); ok { + return n + } + } + return nil +} + +func (c *objCompiler) intVal(pname string) *int { + if n := c.numVal(pname); n != nil && n.IsInt() { + n := int(n.Num().Int64()) + return &n + } + return nil +} + +func (c *objCompiler) objVal(pname string) map[string]any { + v, ok := c.obj[pname] + if !ok { + return nil + } + obj, ok := v.(map[string]any) + if !ok { + return nil + } + return obj +} + +func (c *objCompiler) arrVal(pname string) []any { + v, ok := c.obj[pname] + if !ok { + return nil + } + arr, ok := v.([]any) + if !ok { + return nil + } + return arr +} + +// -- + +type InvalidRegexError struct { + URL string + Regex string + Err error +} + +func (e *InvalidRegexError) Error() string { + return fmt.Sprintf("invalid regex %q at %q: %v", e.Regex, e.URL, e.Err) +} + +// -- + +func toStrings(arr []any) []string { + var strings []string + for _, item := range arr { + if s, ok := item.(string); ok { + strings = append(strings, s) + } + } + return strings +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/output.go b/vendor/github.com/santhosh-tekuri/jsonschema/v6/output.go new file mode 100644 index 0000000..69d3f26 --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/output.go @@ -0,0 +1,216 @@ +package jsonschema + +import ( + "encoding/json" + "fmt" + "strings" + + "github.com/santhosh-tekuri/jsonschema/v6/kind" + "golang.org/x/text/language" + "golang.org/x/text/message" +) + +var defaultPrinter = message.NewPrinter(language.English) + +// format --- + +func (e *ValidationError) schemaURL() string { + if ref, ok := e.ErrorKind.(*kind.Reference); ok { + return ref.URL + } else { + return e.SchemaURL + } +} + +func (e *ValidationError) absoluteKeywordLocation() string { + var schemaURL string + var keywordPath []string + if ref, ok := e.ErrorKind.(*kind.Reference); ok { + schemaURL = ref.URL + keywordPath = nil + } else { + schemaURL = e.SchemaURL + keywordPath = e.ErrorKind.KeywordPath() + } + return fmt.Sprintf("%s%s", schemaURL, encode(jsonPtr(keywordPath))) +} + +func (e *ValidationError) skip() bool { + if len(e.Causes) == 1 { + _, ok := e.ErrorKind.(*kind.Reference) + return ok + } + return false +} + +func (e *ValidationError) display(sb *strings.Builder, verbose bool, indent int, absKwLoc string, p *message.Printer) { + if !e.skip() { + if indent > 0 { + sb.WriteByte('\n') + for i := 0; i < indent-1; i++ { + sb.WriteString(" ") + } + sb.WriteString("- ") + } + indent = indent + 1 + + prevAbsKwLoc := absKwLoc + absKwLoc = e.absoluteKeywordLocation() + + if _, ok := e.ErrorKind.(*kind.Schema); ok { + sb.WriteString(e.ErrorKind.LocalizedString(p)) + } else { + sb.WriteString(p.Sprintf("at %s", quote(jsonPtr(e.InstanceLocation)))) + if verbose { + schLoc := absKwLoc + if prevAbsKwLoc != "" { + pu, _ := split(prevAbsKwLoc) + u, f := split(absKwLoc) + if u == pu { + schLoc = fmt.Sprintf("S#%s", f) + } + } + fmt.Fprintf(sb, " [%s]", schLoc) + } + fmt.Fprintf(sb, ": %s", e.ErrorKind.LocalizedString(p)) + } + } + for _, cause := range e.Causes { + cause.display(sb, verbose, indent, absKwLoc, p) + } +} + +func (e *ValidationError) Error() string { + return e.LocalizedError(defaultPrinter) +} + +func (e *ValidationError) LocalizedError(p *message.Printer) string { + var sb strings.Builder + e.display(&sb, false, 0, "", p) + return sb.String() +} + +func (e *ValidationError) GoString() string { + return e.LocalizedGoString(defaultPrinter) +} + +func (e *ValidationError) LocalizedGoString(p *message.Printer) string { + var sb strings.Builder + e.display(&sb, true, 0, "", p) + return sb.String() +} + +func jsonPtr(tokens []string) string { + var sb strings.Builder + for _, tok := range tokens { + sb.WriteByte('/') + sb.WriteString(escape(tok)) + } + return sb.String() +} + +// -- + +// Flag is output format with simple boolean property valid. +type FlagOutput struct { + Valid bool `json:"valid"` +} + +// The `Flag` output format, merely the boolean result. +func (e *ValidationError) FlagOutput() *FlagOutput { + return &FlagOutput{Valid: false} +} + +// -- + +type OutputUnit struct { + Valid bool `json:"valid"` + KeywordLocation string `json:"keywordLocation"` + AbsoluteKeywordLocation string `json:"AbsoluteKeywordLocation,omitempty"` + InstanceLocation string `json:"instanceLocation"` + Error *OutputError `json:"error,omitempty"` + Errors []OutputUnit `json:"errors,omitempty"` +} + +type OutputError struct { + Kind ErrorKind + p *message.Printer +} + +func (k OutputError) String() string { + return k.Kind.LocalizedString(k.p) +} + +func (k OutputError) MarshalJSON() ([]byte, error) { + return json.Marshal(k.Kind.LocalizedString(k.p)) +} + +// The `Basic` structure, a flat list of output units. +func (e *ValidationError) BasicOutput() *OutputUnit { + return e.LocalizedBasicOutput(defaultPrinter) +} + +func (e *ValidationError) LocalizedBasicOutput(p *message.Printer) *OutputUnit { + out := e.output(true, false, "", "", p) + return &out +} + +// The `Detailed` structure, based on the schema. +func (e *ValidationError) DetailedOutput() *OutputUnit { + return e.LocalizedDetailedOutput(defaultPrinter) +} + +func (e *ValidationError) LocalizedDetailedOutput(p *message.Printer) *OutputUnit { + out := e.output(false, false, "", "", p) + return &out +} + +func (e *ValidationError) output(flatten, inRef bool, schemaURL, kwLoc string, p *message.Printer) OutputUnit { + if !inRef { + if _, ok := e.ErrorKind.(*kind.Reference); ok { + inRef = true + } + } + if schemaURL != "" { + kwLoc += e.SchemaURL[len(schemaURL):] + if ref, ok := e.ErrorKind.(*kind.Reference); ok { + kwLoc += jsonPtr(ref.KeywordPath()) + } + } + schemaURL = e.schemaURL() + + keywordLocation := kwLoc + if _, ok := e.ErrorKind.(*kind.Reference); !ok { + keywordLocation += jsonPtr(e.ErrorKind.KeywordPath()) + } + + out := OutputUnit{ + Valid: false, + InstanceLocation: jsonPtr(e.InstanceLocation), + KeywordLocation: keywordLocation, + } + if inRef { + out.AbsoluteKeywordLocation = e.absoluteKeywordLocation() + } + for _, cause := range e.Causes { + causeOut := cause.output(flatten, inRef, schemaURL, kwLoc, p) + if cause.skip() { + causeOut = causeOut.Errors[0] + } + if flatten { + errors := causeOut.Errors + causeOut.Errors = nil + causeOut.Error = &OutputError{cause.ErrorKind, p} + out.Errors = append(out.Errors, causeOut) + if len(errors) > 0 { + out.Errors = append(out.Errors, errors...) + } + } else { + out.Errors = append(out.Errors, causeOut) + } + } + if len(out.Errors) == 0 { + out.Error = &OutputError{e.ErrorKind, p} + } + return out +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/position.go b/vendor/github.com/santhosh-tekuri/jsonschema/v6/position.go new file mode 100644 index 0000000..576a2a4 --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/position.go @@ -0,0 +1,142 @@ +package jsonschema + +import ( + "strconv" + "strings" +) + +// Position tells possible tokens in json. +type Position interface { + collect(v any, ptr jsonPointer) map[jsonPointer]any +} + +// -- + +type AllProp struct{} + +func (AllProp) collect(v any, ptr jsonPointer) map[jsonPointer]any { + obj, ok := v.(map[string]any) + if !ok { + return nil + } + m := map[jsonPointer]any{} + for pname, pvalue := range obj { + m[ptr.append(pname)] = pvalue + } + return m +} + +// -- + +type AllItem struct{} + +func (AllItem) collect(v any, ptr jsonPointer) map[jsonPointer]any { + arr, ok := v.([]any) + if !ok { + return nil + } + m := map[jsonPointer]any{} + for i, item := range arr { + m[ptr.append(strconv.Itoa(i))] = item + } + return m +} + +// -- + +type Prop string + +func (p Prop) collect(v any, ptr jsonPointer) map[jsonPointer]any { + obj, ok := v.(map[string]any) + if !ok { + return nil + } + pvalue, ok := obj[string(p)] + if !ok { + return nil + } + return map[jsonPointer]any{ + ptr.append(string(p)): pvalue, + } +} + +// -- + +type Item int + +func (i Item) collect(v any, ptr jsonPointer) map[jsonPointer]any { + arr, ok := v.([]any) + if !ok { + return nil + } + if i < 0 || int(i) >= len(arr) { + return nil + } + return map[jsonPointer]any{ + ptr.append(strconv.Itoa(int(i))): arr[int(i)], + } +} + +// -- + +// SchemaPath tells where to look for subschema inside keyword. +type SchemaPath []Position + +func schemaPath(path string) SchemaPath { + var sp SchemaPath + for _, tok := range strings.Split(path, "/") { + var pos Position + switch tok { + case "*": + pos = AllProp{} + case "[]": + pos = AllItem{} + default: + if i, err := strconv.Atoi(tok); err == nil { + pos = Item(i) + } else { + pos = Prop(tok) + } + } + sp = append(sp, pos) + } + return sp +} + +func (sp SchemaPath) collect(v any, ptr jsonPointer) map[jsonPointer]any { + if len(sp) == 0 { + return map[jsonPointer]any{ + ptr: v, + } + } + p, sp := sp[0], sp[1:] + m := p.collect(v, ptr) + mm := map[jsonPointer]any{} + for ptr, v := range m { + m = sp.collect(v, ptr) + for k, v := range m { + mm[k] = v + } + } + return mm +} + +func (sp SchemaPath) String() string { + var sb strings.Builder + for _, pos := range sp { + if sb.Len() != 0 { + sb.WriteByte('/') + } + switch pos := pos.(type) { + case AllProp: + sb.WriteString("*") + case AllItem: + sb.WriteString("[]") + case Prop: + sb.WriteString(string(pos)) + case Item: + sb.WriteString(strconv.Itoa(int(pos))) + } + } + return sb.String() +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/root.go b/vendor/github.com/santhosh-tekuri/jsonschema/v6/root.go new file mode 100644 index 0000000..a8b819b --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/root.go @@ -0,0 +1,202 @@ +package jsonschema + +import ( + "fmt" + "slices" + "strings" +) + +type root struct { + url url + doc any + resources map[jsonPointer]*resource + subschemasProcessed map[jsonPointer]struct{} +} + +func (r *root) rootResource() *resource { + return r.resources[""] +} + +func (r *root) resource(ptr jsonPointer) *resource { + for { + if res, ok := r.resources[ptr]; ok { + return res + } + slash := strings.LastIndexByte(string(ptr), '/') + if slash == -1 { + break + } + ptr = ptr[:slash] + } + return r.rootResource() +} + +func (r *root) resolveFragmentIn(frag fragment, res *resource) (urlPtr, error) { + var ptr jsonPointer + switch f := frag.convert().(type) { + case jsonPointer: + ptr = res.ptr.concat(f) + case anchor: + aptr, ok := res.anchors[f] + if !ok { + return urlPtr{}, &AnchorNotFoundError{ + URL: r.url.String(), + Reference: (&urlFrag{res.id, frag}).String(), + } + } + ptr = aptr + } + return urlPtr{r.url, ptr}, nil +} + +func (r *root) resolveFragment(frag fragment) (urlPtr, error) { + return r.resolveFragmentIn(frag, r.rootResource()) +} + +// resolves urlFrag to urlPtr from root. +// returns nil if it is external. +func (r *root) resolve(uf urlFrag) (*urlPtr, error) { + var res *resource + if uf.url == r.url { + res = r.rootResource() + } else { + // look for resource with id==uf.url + for _, v := range r.resources { + if v.id == uf.url { + res = v + break + } + } + if res == nil { + return nil, nil // external url + } + } + up, err := r.resolveFragmentIn(uf.frag, res) + return &up, err +} + +func (r *root) collectAnchors(sch any, schPtr jsonPointer, res *resource) error { + obj, ok := sch.(map[string]any) + if !ok { + return nil + } + + addAnchor := func(anchor anchor) error { + ptr1, ok := res.anchors[anchor] + if ok { + if ptr1 == schPtr { + // anchor with same root_ptr already exists + return nil + } + return &DuplicateAnchorError{ + string(anchor), r.url.String(), string(ptr1), string(schPtr), + } + } + res.anchors[anchor] = schPtr + return nil + } + + if res.dialect.draft.version < 2019 { + if _, ok := obj["$ref"]; ok { + // All other properties in a "$ref" object MUST be ignored + return nil + } + // anchor is specified in id + if id, ok := strVal(obj, res.dialect.draft.id); ok { + _, frag, err := splitFragment(id) + if err != nil { + loc := urlPtr{r.url, schPtr} + return &ParseAnchorError{loc.String()} + } + if anchor, ok := frag.convert().(anchor); ok { + if err := addAnchor(anchor); err != nil { + return err + } + } + } + } + if res.dialect.draft.version >= 2019 { + if s, ok := strVal(obj, "$anchor"); ok { + if err := addAnchor(anchor(s)); err != nil { + return err + } + } + } + if res.dialect.draft.version >= 2020 { + if s, ok := strVal(obj, "$dynamicAnchor"); ok { + if err := addAnchor(anchor(s)); err != nil { + return err + } + res.dynamicAnchors = append(res.dynamicAnchors, anchor(s)) + } + } + + return nil +} + +func (r *root) clone() *root { + processed := map[jsonPointer]struct{}{} + for k := range r.subschemasProcessed { + processed[k] = struct{}{} + } + resources := map[jsonPointer]*resource{} + for k, v := range r.resources { + resources[k] = v.clone() + } + return &root{ + url: r.url, + doc: r.doc, + resources: resources, + subschemasProcessed: processed, + } +} + +// -- + +type resource struct { + ptr jsonPointer + id url + dialect dialect + anchors map[anchor]jsonPointer + dynamicAnchors []anchor +} + +func newResource(ptr jsonPointer, id url) *resource { + return &resource{ptr: ptr, id: id, anchors: make(map[anchor]jsonPointer)} +} + +func (res *resource) clone() *resource { + anchors := map[anchor]jsonPointer{} + for k, v := range res.anchors { + anchors[k] = v + } + return &resource{ + ptr: res.ptr, + id: res.id, + dialect: res.dialect, + anchors: anchors, + dynamicAnchors: slices.Clone(res.dynamicAnchors), + } +} + +//-- + +type UnsupportedVocabularyError struct { + URL string + Vocabulary string +} + +func (e *UnsupportedVocabularyError) Error() string { + return fmt.Sprintf("unsupported vocabulary %q in %q", e.Vocabulary, e.URL) +} + +// -- + +type AnchorNotFoundError struct { + URL string + Reference string +} + +func (e *AnchorNotFoundError) Error() string { + return fmt.Sprintf("anchor in %q not found in schema %q", e.Reference, e.URL) +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/roots.go b/vendor/github.com/santhosh-tekuri/jsonschema/v6/roots.go new file mode 100644 index 0000000..a8d0ef0 --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/roots.go @@ -0,0 +1,286 @@ +package jsonschema + +import ( + "fmt" + "strings" +) + +type roots struct { + defaultDraft *Draft + roots map[url]*root + loader defaultLoader + regexpEngine RegexpEngine + vocabularies map[string]*Vocabulary + assertVocabs bool +} + +func newRoots() *roots { + return &roots{ + defaultDraft: draftLatest, + roots: map[url]*root{}, + loader: defaultLoader{ + docs: map[url]any{}, + loader: FileLoader{}, + }, + regexpEngine: goRegexpCompile, + vocabularies: map[string]*Vocabulary{}, + } +} + +func (rr *roots) orLoad(u url) (*root, error) { + if r, ok := rr.roots[u]; ok { + return r, nil + } + doc, err := rr.loader.load(u) + if err != nil { + return nil, err + } + return rr.addRoot(u, doc) +} + +func (rr *roots) addRoot(u url, doc any) (*root, error) { + r := &root{ + url: u, + doc: doc, + resources: map[jsonPointer]*resource{}, + subschemasProcessed: map[jsonPointer]struct{}{}, + } + if err := rr.collectResources(r, doc, u, "", dialect{rr.defaultDraft, nil}); err != nil { + return nil, err + } + if !strings.HasPrefix(u.String(), "http://json-schema.org/") && + !strings.HasPrefix(u.String(), "https://json-schema.org/") { + if err := rr.validate(r, doc, ""); err != nil { + return nil, err + } + } + + rr.roots[u] = r + return r, nil +} + +func (rr *roots) resolveFragment(uf urlFrag) (urlPtr, error) { + r, err := rr.orLoad(uf.url) + if err != nil { + return urlPtr{}, err + } + return r.resolveFragment(uf.frag) +} + +func (rr *roots) collectResources(r *root, sch any, base url, schPtr jsonPointer, fallback dialect) error { + if _, ok := r.subschemasProcessed[schPtr]; ok { + return nil + } + if err := rr._collectResources(r, sch, base, schPtr, fallback); err != nil { + return err + } + r.subschemasProcessed[schPtr] = struct{}{} + return nil +} + +func (rr *roots) _collectResources(r *root, sch any, base url, schPtr jsonPointer, fallback dialect) error { + obj, ok := sch.(map[string]any) + if !ok { + if schPtr.isEmpty() { + // root resource + res := newResource(schPtr, base) + res.dialect = fallback + r.resources[schPtr] = res + } + return nil + } + + hasSchema := false + if sch, ok := obj["$schema"]; ok { + if _, ok := sch.(string); ok { + hasSchema = true + } + } + + draft, err := rr.loader.getDraft(urlPtr{r.url, schPtr}, sch, fallback.draft, map[url]struct{}{}) + if err != nil { + return err + } + id := draft.getID(obj) + if id == "" && !schPtr.isEmpty() { + // ignore $schema + draft = fallback.draft + hasSchema = false + id = draft.getID(obj) + } + + var res *resource + if id != "" { + uf, err := base.join(id) + if err != nil { + loc := urlPtr{r.url, schPtr} + return &ParseIDError{loc.String()} + } + base = uf.url + res = newResource(schPtr, base) + } else if schPtr.isEmpty() { + // root resource + res = newResource(schPtr, base) + } + + if res != nil { + found := false + for _, res := range r.resources { + if res.id == base { + found = true + if res.ptr != schPtr { + return &DuplicateIDError{base.String(), r.url.String(), string(schPtr), string(res.ptr)} + } + } + } + if !found { + if hasSchema { + vocabs, err := rr.loader.getMetaVocabs(sch, draft, rr.vocabularies) + if err != nil { + return err + } + res.dialect = dialect{draft, vocabs} + } else { + res.dialect = fallback + } + r.resources[schPtr] = res + } + } + + var baseRes *resource + for _, res := range r.resources { + if res.id == base { + baseRes = res + break + } + } + if baseRes == nil { + panic("baseres is nil") + } + + // found base resource + if err := r.collectAnchors(sch, schPtr, baseRes); err != nil { + return err + } + + // process subschemas + subschemas := map[jsonPointer]any{} + for _, sp := range draft.subschemas { + ss := sp.collect(obj, schPtr) + for k, v := range ss { + subschemas[k] = v + } + } + for _, vocab := range baseRes.dialect.activeVocabs(true, rr.vocabularies) { + if v := rr.vocabularies[vocab]; v != nil { + for _, sp := range v.Subschemas { + ss := sp.collect(obj, schPtr) + for k, v := range ss { + subschemas[k] = v + } + } + } + } + for ptr, v := range subschemas { + if err := rr.collectResources(r, v, base, ptr, baseRes.dialect); err != nil { + return err + } + } + + return nil +} + +func (rr *roots) ensureSubschema(up urlPtr) error { + r, err := rr.orLoad(up.url) + if err != nil { + return err + } + if _, ok := r.subschemasProcessed[up.ptr]; ok { + return nil + } + v, err := up.lookup(r.doc) + if err != nil { + return err + } + rClone := r.clone() + if err := rr.addSubschema(rClone, up.ptr); err != nil { + return err + } + if err := rr.validate(rClone, v, up.ptr); err != nil { + return err + } + rr.roots[r.url] = rClone + return nil +} + +func (rr *roots) addSubschema(r *root, ptr jsonPointer) error { + v, err := (&urlPtr{r.url, ptr}).lookup(r.doc) + if err != nil { + return err + } + base := r.resource(ptr) + baseURL := base.id + if err := rr.collectResources(r, v, baseURL, ptr, base.dialect); err != nil { + return err + } + + // collect anchors + if _, ok := r.resources[ptr]; !ok { + res := r.resource(ptr) + if err := r.collectAnchors(v, ptr, res); err != nil { + return err + } + } + return nil +} + +func (rr *roots) validate(r *root, v any, ptr jsonPointer) error { + dialect := r.resource(ptr).dialect + meta := dialect.getSchema(rr.assertVocabs, rr.vocabularies) + if err := meta.validate(v, rr.regexpEngine, meta, r.resources, rr.assertVocabs, rr.vocabularies); err != nil { + up := urlPtr{r.url, ptr} + return &SchemaValidationError{URL: up.String(), Err: err} + } + return nil +} + +// -- + +type InvalidMetaSchemaURLError struct { + URL string + Err error +} + +func (e *InvalidMetaSchemaURLError) Error() string { + return fmt.Sprintf("invalid $schema in %q: %v", e.URL, e.Err) +} + +// -- + +type UnsupportedDraftError struct { + URL string +} + +func (e *UnsupportedDraftError) Error() string { + return fmt.Sprintf("draft %q is not supported", e.URL) +} + +// -- + +type MetaSchemaCycleError struct { + URL string +} + +func (e *MetaSchemaCycleError) Error() string { + return fmt.Sprintf("cycle in resolving $schema in %q", e.URL) +} + +// -- + +type MetaSchemaMismatchError struct { + URL string +} + +func (e *MetaSchemaMismatchError) Error() string { + return fmt.Sprintf("$schema in %q does not match with $schema in root", e.URL) +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/schema.go b/vendor/github.com/santhosh-tekuri/jsonschema/v6/schema.go new file mode 100644 index 0000000..b4c1f37 --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/schema.go @@ -0,0 +1,254 @@ +package jsonschema + +import ( + "encoding/json" + "fmt" + "math/big" +) + +// Schema is the representation of a compiled +// jsonschema. +type Schema struct { + up urlPtr + resource *Schema + dynamicAnchors map[string]*Schema + allPropsEvaluated bool + allItemsEvaluated bool + numItemsEvaluated int + + DraftVersion int + Location string + + // type agnostic -- + Bool *bool // boolean schema + ID string + Ref *Schema + Anchor string + RecursiveRef *Schema + RecursiveAnchor bool + DynamicRef *DynamicRef + DynamicAnchor string // "" if not specified + Types *Types + Enum *Enum + Const *any + Not *Schema + AllOf []*Schema + AnyOf []*Schema + OneOf []*Schema + If *Schema + Then *Schema + Else *Schema + Format *Format + + // object -- + MaxProperties *int + MinProperties *int + Required []string + PropertyNames *Schema + Properties map[string]*Schema + PatternProperties map[Regexp]*Schema + AdditionalProperties any // nil or bool or *Schema + Dependencies map[string]any // value is []string or *Schema + DependentRequired map[string][]string + DependentSchemas map[string]*Schema + UnevaluatedProperties *Schema + + // array -- + MinItems *int + MaxItems *int + UniqueItems bool + Contains *Schema + MinContains *int + MaxContains *int + Items any // nil or []*Schema or *Schema + AdditionalItems any // nil or bool or *Schema + PrefixItems []*Schema + Items2020 *Schema + UnevaluatedItems *Schema + + // string -- + MinLength *int + MaxLength *int + Pattern Regexp + ContentEncoding *Decoder + ContentMediaType *MediaType + ContentSchema *Schema + + // number -- + Maximum *big.Rat + Minimum *big.Rat + ExclusiveMaximum *big.Rat + ExclusiveMinimum *big.Rat + MultipleOf *big.Rat + + Extensions []SchemaExt + + // annotations -- + Title string + Description string + Default *any + Comment string + ReadOnly bool + WriteOnly bool + Examples []any + Deprecated bool +} + +// -- + +type jsonType int + +const ( + invalidType jsonType = 0 + nullType jsonType = 1 << iota + booleanType + numberType + integerType + stringType + arrayType + objectType +) + +func typeOf(v any) jsonType { + switch v.(type) { + case nil: + return nullType + case bool: + return booleanType + case json.Number, float32, float64, int, int8, int16, int32, int64, uint, uint8, uint16, uint32, uint64: + return numberType + case string: + return stringType + case []any: + return arrayType + case map[string]any: + return objectType + default: + return invalidType + } +} + +func typeFromString(s string) jsonType { + switch s { + case "null": + return nullType + case "boolean": + return booleanType + case "number": + return numberType + case "integer": + return integerType + case "string": + return stringType + case "array": + return arrayType + case "object": + return objectType + } + return invalidType +} + +func (jt jsonType) String() string { + switch jt { + case nullType: + return "null" + case booleanType: + return "boolean" + case numberType: + return "number" + case integerType: + return "integer" + case stringType: + return "string" + case arrayType: + return "array" + case objectType: + return "object" + } + return "" +} + +// -- + +// Types encapsulates list of json value types. +type Types int + +func newTypes(v any) *Types { + var types Types + switch v := v.(type) { + case string: + types.Add(v) + case []any: + for _, item := range v { + if s, ok := item.(string); ok { + types.Add(s) + } + } + } + if types.IsEmpty() { + return nil + } + return &types +} + +func (tt Types) IsEmpty() bool { + return tt == 0 +} + +// Add specified json type. If typ is +// not valid json type it is ignored. +func (tt *Types) Add(typ string) { + tt.add(typeFromString(typ)) +} + +func (tt *Types) add(t jsonType) { + *tt = Types(int(*tt) | int(t)) +} + +func (tt Types) contains(t jsonType) bool { + return int(tt)&int(t) != 0 +} + +func (tt Types) ToStrings() []string { + types := []jsonType{ + nullType, booleanType, numberType, integerType, + stringType, arrayType, objectType, + } + var arr []string + for _, t := range types { + if tt.contains(t) { + arr = append(arr, t.String()) + } + } + return arr +} + +func (tt Types) String() string { + return fmt.Sprintf("%v", tt.ToStrings()) +} + +// -- + +type Enum struct { + Values []any + types Types +} + +func newEnum(arr []any) *Enum { + var types Types + for _, item := range arr { + types.add(typeOf(item)) + } + return &Enum{arr, types} +} + +// -- + +type DynamicRef struct { + Ref *Schema + Anchor string // "" if not specified +} + +func newSchema(up urlPtr) *Schema { + return &Schema{up: up, Location: up.String()} +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/util.go b/vendor/github.com/santhosh-tekuri/jsonschema/v6/util.go new file mode 100644 index 0000000..c6f8e77 --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/util.go @@ -0,0 +1,464 @@ +package jsonschema + +import ( + "encoding/json" + "fmt" + "hash/maphash" + "math/big" + gourl "net/url" + "path/filepath" + "runtime" + "slices" + "strconv" + "strings" + + "github.com/santhosh-tekuri/jsonschema/v6/kind" + "golang.org/x/text/message" +) + +// -- + +type url (string) + +func (u url) String() string { + return string(u) +} + +func (u url) join(ref string) (*urlFrag, error) { + base, err := gourl.Parse(string(u)) + if err != nil { + return nil, &ParseURLError{URL: u.String(), Err: err} + } + + ref, frag, err := splitFragment(ref) + if err != nil { + return nil, err + } + refURL, err := gourl.Parse(ref) + if err != nil { + return nil, &ParseURLError{URL: ref, Err: err} + } + resolved := base.ResolveReference(refURL) + + // see https://github.com/golang/go/issues/66084 (net/url: ResolveReference ignores Opaque value) + if !refURL.IsAbs() && base.Opaque != "" { + resolved.Opaque = base.Opaque + } + + return &urlFrag{url: url(resolved.String()), frag: frag}, nil +} + +// -- + +type jsonPointer string + +func escape(tok string) string { + tok = strings.ReplaceAll(tok, "~", "~0") + tok = strings.ReplaceAll(tok, "/", "~1") + return tok +} + +func unescape(tok string) (string, bool) { + tilde := strings.IndexByte(tok, '~') + if tilde == -1 { + return tok, true + } + sb := new(strings.Builder) + for { + sb.WriteString(tok[:tilde]) + tok = tok[tilde+1:] + if tok == "" { + return "", false + } + switch tok[0] { + case '0': + sb.WriteByte('~') + case '1': + sb.WriteByte('/') + default: + return "", false + } + tok = tok[1:] + tilde = strings.IndexByte(tok, '~') + if tilde == -1 { + sb.WriteString(tok) + break + } + } + return sb.String(), true +} + +func (ptr jsonPointer) isEmpty() bool { + return string(ptr) == "" +} + +func (ptr jsonPointer) concat(next jsonPointer) jsonPointer { + return jsonPointer(fmt.Sprintf("%s%s", ptr, next)) +} + +func (ptr jsonPointer) append(tok string) jsonPointer { + return jsonPointer(fmt.Sprintf("%s/%s", ptr, escape(tok))) +} + +func (ptr jsonPointer) append2(tok1, tok2 string) jsonPointer { + return jsonPointer(fmt.Sprintf("%s/%s/%s", ptr, escape(tok1), escape(tok2))) +} + +// -- + +type anchor string + +// -- + +type fragment string + +func decode(frag string) (string, error) { + return gourl.PathUnescape(frag) +} + +// avoids escaping /. +func encode(frag string) string { + var sb strings.Builder + for i, tok := range strings.Split(frag, "/") { + if i > 0 { + sb.WriteByte('/') + } + sb.WriteString(gourl.PathEscape(tok)) + } + return sb.String() +} + +func splitFragment(str string) (string, fragment, error) { + u, f := split(str) + f, err := decode(f) + if err != nil { + return "", fragment(""), &ParseURLError{URL: str, Err: err} + } + return u, fragment(f), nil +} + +func split(str string) (string, string) { + hash := strings.IndexByte(str, '#') + if hash == -1 { + return str, "" + } + return str[:hash], str[hash+1:] +} + +func (frag fragment) convert() any { + str := string(frag) + if str == "" || strings.HasPrefix(str, "/") { + return jsonPointer(str) + } + return anchor(str) +} + +// -- + +type urlFrag struct { + url url + frag fragment +} + +func startsWithWindowsDrive(s string) bool { + if s != "" && strings.HasPrefix(s[1:], `:\`) { + return (s[0] >= 'a' && s[0] <= 'z') || (s[0] >= 'A' && s[0] <= 'Z') + } + return false +} + +func absolute(input string) (*urlFrag, error) { + u, frag, err := splitFragment(input) + if err != nil { + return nil, err + } + + // if windows absolute file path, convert to file url + // because: net/url parses driver name as scheme + if runtime.GOOS == "windows" && startsWithWindowsDrive(u) { + u = "file:///" + filepath.ToSlash(u) + } + + gourl, err := gourl.Parse(u) + if err != nil { + return nil, &ParseURLError{URL: input, Err: err} + } + if gourl.IsAbs() { + return &urlFrag{url(u), frag}, nil + } + + // avoid filesystem api in wasm + if runtime.GOOS != "js" { + abs, err := filepath.Abs(u) + if err != nil { + return nil, &ParseURLError{URL: input, Err: err} + } + u = abs + } + if !strings.HasPrefix(u, "/") { + u = "/" + u + } + u = "file://" + filepath.ToSlash(u) + + _, err = gourl.Parse(u) + if err != nil { + return nil, &ParseURLError{URL: input, Err: err} + } + return &urlFrag{url: url(u), frag: frag}, nil +} + +func (uf *urlFrag) String() string { + return fmt.Sprintf("%s#%s", uf.url, encode(string(uf.frag))) +} + +// -- + +type urlPtr struct { + url url + ptr jsonPointer +} + +func (up *urlPtr) lookup(v any) (any, error) { + for _, tok := range strings.Split(string(up.ptr), "/")[1:] { + tok, ok := unescape(tok) + if !ok { + return nil, &InvalidJsonPointerError{up.String()} + } + switch val := v.(type) { + case map[string]any: + if pvalue, ok := val[tok]; ok { + v = pvalue + continue + } + case []any: + if index, err := strconv.Atoi(tok); err == nil { + if index >= 0 && index < len(val) { + v = val[index] + continue + } + } + } + return nil, &JSONPointerNotFoundError{up.String()} + } + return v, nil +} + +func (up *urlPtr) format(tok string) string { + return fmt.Sprintf("%s#%s/%s", up.url, encode(string(up.ptr)), encode(escape(tok))) +} + +func (up *urlPtr) String() string { + return fmt.Sprintf("%s#%s", up.url, encode(string(up.ptr))) +} + +// -- + +func minInt(i, j int) int { + if i < j { + return i + } + return j +} + +func strVal(obj map[string]any, prop string) (string, bool) { + v, ok := obj[prop] + if !ok { + return "", false + } + s, ok := v.(string) + return s, ok +} + +func isInteger(num any) bool { + rat, ok := new(big.Rat).SetString(fmt.Sprint(num)) + return ok && rat.IsInt() +} + +// quote returns single-quoted string. +// used for embedding quoted strings in json. +func quote(s string) string { + s = fmt.Sprintf("%q", s) + s = strings.ReplaceAll(s, `\"`, `"`) + s = strings.ReplaceAll(s, `'`, `\'`) + return "'" + s[1:len(s)-1] + "'" +} + +func equals(v1, v2 any) (bool, ErrorKind) { + switch v1 := v1.(type) { + case map[string]any: + v2, ok := v2.(map[string]any) + if !ok || len(v1) != len(v2) { + return false, nil + } + for k, val1 := range v1 { + val2, ok := v2[k] + if !ok { + return false, nil + } + if ok, k := equals(val1, val2); !ok || k != nil { + return ok, k + } + } + return true, nil + case []any: + v2, ok := v2.([]any) + if !ok || len(v1) != len(v2) { + return false, nil + } + for i := range v1 { + if ok, k := equals(v1[i], v2[i]); !ok || k != nil { + return ok, k + } + } + return true, nil + case nil: + return v2 == nil, nil + case bool: + v2, ok := v2.(bool) + return ok && v1 == v2, nil + case string: + v2, ok := v2.(string) + return ok && v1 == v2, nil + case json.Number, float32, float64, int, int8, int16, int32, int64, uint, uint8, uint16, uint32, uint64: + num1, ok1 := new(big.Rat).SetString(fmt.Sprint(v1)) + num2, ok2 := new(big.Rat).SetString(fmt.Sprint(v2)) + return ok1 && ok2 && num1.Cmp(num2) == 0, nil + default: + return false, &kind.InvalidJsonValue{Value: v1} + } +} + +func duplicates(arr []any) (int, int, ErrorKind) { + if len(arr) <= 20 { + for i := 1; i < len(arr); i++ { + for j := 0; j < i; j++ { + if ok, k := equals(arr[i], arr[j]); ok || k != nil { + return j, i, k + } + } + } + return -1, -1, nil + } + + m := make(map[uint64][]int) + h := new(maphash.Hash) + for i, item := range arr { + h.Reset() + writeHash(item, h) + hash := h.Sum64() + indexes, ok := m[hash] + if ok { + for _, j := range indexes { + if ok, k := equals(item, arr[j]); ok || k != nil { + return j, i, k + } + } + } + indexes = append(indexes, i) + m[hash] = indexes + } + return -1, -1, nil +} + +func writeHash(v any, h *maphash.Hash) ErrorKind { + switch v := v.(type) { + case map[string]any: + _ = h.WriteByte(0) + props := make([]string, 0, len(v)) + for prop := range v { + props = append(props, prop) + } + slices.Sort(props) + for _, prop := range props { + writeHash(prop, h) + writeHash(v[prop], h) + } + case []any: + _ = h.WriteByte(1) + for _, item := range v { + writeHash(item, h) + } + case nil: + _ = h.WriteByte(2) + case bool: + _ = h.WriteByte(3) + if v { + _ = h.WriteByte(1) + } else { + _ = h.WriteByte(0) + } + case string: + _ = h.WriteByte(4) + _, _ = h.WriteString(v) + case json.Number, float32, float64, int, int8, int16, int32, int64, uint, uint8, uint16, uint32, uint64: + _ = h.WriteByte(5) + num, _ := new(big.Rat).SetString(fmt.Sprint(v)) + _, _ = h.Write(num.Num().Bytes()) + _, _ = h.Write(num.Denom().Bytes()) + default: + return &kind.InvalidJsonValue{Value: v} + } + return nil +} + +// -- + +type ParseURLError struct { + URL string + Err error +} + +func (e *ParseURLError) Error() string { + return fmt.Sprintf("error in parsing %q: %v", e.URL, e.Err) +} + +// -- + +type InvalidJsonPointerError struct { + URL string +} + +func (e *InvalidJsonPointerError) Error() string { + return fmt.Sprintf("invalid json-pointer %q", e.URL) +} + +// -- + +type JSONPointerNotFoundError struct { + URL string +} + +func (e *JSONPointerNotFoundError) Error() string { + return fmt.Sprintf("json-pointer in %q not found", e.URL) +} + +// -- + +type SchemaValidationError struct { + URL string + Err error +} + +func (e *SchemaValidationError) Error() string { + return fmt.Sprintf("%q is not valid against metaschema: %v", e.URL, e.Err) +} + +// -- + +// LocalizableError is an error whose message is localizable. +func LocalizableError(format string, args ...any) error { + return &localizableError{format, args} +} + +type localizableError struct { + msg string + args []any +} + +func (e *localizableError) Error() string { + return fmt.Sprintf(e.msg, e.args...) +} + +func (e *localizableError) LocalizedError(p *message.Printer) string { + return p.Sprintf(e.msg, e.args...) +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/validator.go b/vendor/github.com/santhosh-tekuri/jsonschema/v6/validator.go new file mode 100644 index 0000000..e2ace37 --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/validator.go @@ -0,0 +1,975 @@ +package jsonschema + +import ( + "encoding/json" + "fmt" + "math/big" + "slices" + "strconv" + "unicode/utf8" + + "github.com/santhosh-tekuri/jsonschema/v6/kind" + "golang.org/x/text/message" +) + +func (sch *Schema) Validate(v any) error { + return sch.validate(v, nil, nil, nil, false, nil) +} + +func (sch *Schema) validate(v any, regexpEngine RegexpEngine, meta *Schema, resources map[jsonPointer]*resource, assertVocabs bool, vocabularies map[string]*Vocabulary) error { + vd := validator{ + v: v, + vloc: make([]string, 0, 8), + sch: sch, + scp: &scope{sch, "", 0, nil}, + uneval: unevalFrom(v, sch, false), + errors: nil, + boolResult: false, + regexpEngine: regexpEngine, + meta: meta, + resources: resources, + assertVocabs: assertVocabs, + vocabularies: vocabularies, + } + if _, err := vd.validate(); err != nil { + verr := err.(*ValidationError) + var causes []*ValidationError + if _, ok := verr.ErrorKind.(*kind.Group); ok { + causes = verr.Causes + } else { + causes = []*ValidationError{verr} + } + return &ValidationError{ + SchemaURL: sch.Location, + InstanceLocation: nil, + ErrorKind: &kind.Schema{Location: sch.Location}, + Causes: causes, + } + } + + return nil +} + +type validator struct { + v any + vloc []string + sch *Schema + scp *scope + uneval *uneval + errors []*ValidationError + boolResult bool // is interested to know valid or not (but not actuall error) + regexpEngine RegexpEngine + + // meta validation + meta *Schema // set only when validating with metaschema + resources map[jsonPointer]*resource // resources which should be validated with their dialect + assertVocabs bool + vocabularies map[string]*Vocabulary +} + +func (vd *validator) validate() (*uneval, error) { + s := vd.sch + v := vd.v + + // boolean -- + if s.Bool != nil { + if *s.Bool { + return vd.uneval, nil + } else { + return nil, vd.error(&kind.FalseSchema{}) + } + } + + // check cycle -- + if scp := vd.scp.checkCycle(); scp != nil { + return nil, vd.error(&kind.RefCycle{ + URL: s.Location, + KeywordLocation1: vd.scp.kwLoc(), + KeywordLocation2: scp.kwLoc(), + }) + } + + t := typeOf(v) + if t == invalidType { + return nil, vd.error(&kind.InvalidJsonValue{Value: v}) + } + + // type -- + if s.Types != nil && !s.Types.IsEmpty() { + matched := s.Types.contains(t) || (s.Types.contains(integerType) && t == numberType && isInteger(v)) + if !matched { + return nil, vd.error(&kind.Type{Got: t.String(), Want: s.Types.ToStrings()}) + } + } + + // const -- + if s.Const != nil { + ok, k := equals(v, *s.Const) + if k != nil { + return nil, vd.error(k) + } else if !ok { + return nil, vd.error(&kind.Const{Got: v, Want: *s.Const}) + } + } + + // enum -- + if s.Enum != nil { + matched := s.Enum.types.contains(typeOf(v)) + if matched { + matched = false + for _, item := range s.Enum.Values { + ok, k := equals(v, item) + if k != nil { + return nil, vd.error(k) + } else if ok { + matched = true + break + } + } + } + if !matched { + return nil, vd.error(&kind.Enum{Got: v, Want: s.Enum.Values}) + } + } + + // format -- + if s.Format != nil { + var err error + if s.Format.Name == "regex" && vd.regexpEngine != nil { + err = vd.regexpEngine.validate(v) + } else { + err = s.Format.Validate(v) + } + if err != nil { + return nil, vd.error(&kind.Format{Got: v, Want: s.Format.Name, Err: err}) + } + } + + // $ref -- + if s.Ref != nil { + err := vd.validateRef(s.Ref, "$ref") + if s.DraftVersion < 2019 { + return vd.uneval, err + } + if err != nil { + vd.addErr(err) + } + } + + // type specific validations -- + switch v := v.(type) { + case map[string]any: + vd.objValidate(v) + case []any: + vd.arrValidate(v) + case string: + vd.strValidate(v) + case json.Number, float32, float64, int, int8, int16, int32, int64, uint, uint8, uint16, uint32, uint64: + vd.numValidate(v) + } + + if len(vd.errors) == 0 || !vd.boolResult { + if s.DraftVersion >= 2019 { + vd.validateRefs() + } + vd.condValidate() + + for _, ext := range s.Extensions { + ext.Validate(&ValidatorContext{vd}, v) + } + + if s.DraftVersion >= 2019 { + vd.unevalValidate() + } + } + + switch len(vd.errors) { + case 0: + return vd.uneval, nil + case 1: + return nil, vd.errors[0] + default: + verr := vd.error(&kind.Group{}) + verr.Causes = vd.errors + return nil, verr + } +} + +func (vd *validator) objValidate(obj map[string]any) { + s := vd.sch + + // minProperties -- + if s.MinProperties != nil { + if len(obj) < *s.MinProperties { + vd.addError(&kind.MinProperties{Got: len(obj), Want: *s.MinProperties}) + } + } + + // maxProperties -- + if s.MaxProperties != nil { + if len(obj) > *s.MaxProperties { + vd.addError(&kind.MaxProperties{Got: len(obj), Want: *s.MaxProperties}) + } + } + + // required -- + if len(s.Required) > 0 { + if missing := vd.findMissing(obj, s.Required); missing != nil { + vd.addError(&kind.Required{Missing: missing}) + } + } + + if vd.boolResult && len(vd.errors) > 0 { + return + } + + // dependencies -- + for pname, dep := range s.Dependencies { + if _, ok := obj[pname]; ok { + switch dep := dep.(type) { + case []string: + if missing := vd.findMissing(obj, dep); missing != nil { + vd.addError(&kind.Dependency{Prop: pname, Missing: missing}) + } + case *Schema: + vd.addErr(vd.validateSelf(dep, "", false)) + } + } + } + + var additionalPros []string + for pname, pvalue := range obj { + if vd.boolResult && len(vd.errors) > 0 { + return + } + evaluated := false + + // properties -- + if sch, ok := s.Properties[pname]; ok { + evaluated = true + vd.addErr(vd.validateVal(sch, pvalue, pname)) + } + + // patternProperties -- + for regex, sch := range s.PatternProperties { + if regex.MatchString(pname) { + evaluated = true + vd.addErr(vd.validateVal(sch, pvalue, pname)) + } + } + + if !evaluated && s.AdditionalProperties != nil { + evaluated = true + switch additional := s.AdditionalProperties.(type) { + case bool: + if !additional { + additionalPros = append(additionalPros, pname) + } + case *Schema: + vd.addErr(vd.validateVal(additional, pvalue, pname)) + } + } + + if evaluated { + delete(vd.uneval.props, pname) + } + } + if len(additionalPros) > 0 { + vd.addError(&kind.AdditionalProperties{Properties: additionalPros}) + } + + if s.DraftVersion == 4 { + return + } + + // propertyNames -- + if s.PropertyNames != nil { + for pname := range obj { + sch, meta, resources := s.PropertyNames, vd.meta, vd.resources + res := vd.metaResource(sch) + if res != nil { + meta = res.dialect.getSchema(vd.assertVocabs, vd.vocabularies) + sch = meta + } + if err := sch.validate(pname, vd.regexpEngine, meta, resources, vd.assertVocabs, vd.vocabularies); err != nil { + verr := err.(*ValidationError) + verr.SchemaURL = s.PropertyNames.Location + verr.ErrorKind = &kind.PropertyNames{Property: pname} + vd.addErr(verr) + } + } + } + + if s.DraftVersion == 6 { + return + } + + // dependentSchemas -- + for pname, sch := range s.DependentSchemas { + if _, ok := obj[pname]; ok { + vd.addErr(vd.validateSelf(sch, "", false)) + } + } + + // dependentRequired -- + for pname, reqd := range s.DependentRequired { + if _, ok := obj[pname]; ok { + if missing := vd.findMissing(obj, reqd); missing != nil { + vd.addError(&kind.DependentRequired{Prop: pname, Missing: missing}) + } + } + } +} + +func (vd *validator) arrValidate(arr []any) { + s := vd.sch + + // minItems -- + if s.MinItems != nil { + if len(arr) < *s.MinItems { + vd.addError(&kind.MinItems{Got: len(arr), Want: *s.MinItems}) + } + } + + // maxItems -- + if s.MaxItems != nil { + if len(arr) > *s.MaxItems { + vd.addError(&kind.MaxItems{Got: len(arr), Want: *s.MaxItems}) + } + } + + // uniqueItems -- + if s.UniqueItems && len(arr) > 1 { + i, j, k := duplicates(arr) + if k != nil { + vd.addError(k) + } else if i != -1 { + vd.addError(&kind.UniqueItems{Duplicates: [2]int{i, j}}) + } + } + + if s.DraftVersion < 2020 { + evaluated := 0 + + // items -- + switch items := s.Items.(type) { + case *Schema: + for i, item := range arr { + vd.addErr(vd.validateVal(items, item, strconv.Itoa(i))) + } + evaluated = len(arr) + case []*Schema: + min := minInt(len(arr), len(items)) + for i, item := range arr[:min] { + vd.addErr(vd.validateVal(items[i], item, strconv.Itoa(i))) + } + evaluated = min + } + + // additionalItems -- + if s.AdditionalItems != nil { + switch additional := s.AdditionalItems.(type) { + case bool: + if !additional && evaluated != len(arr) { + vd.addError(&kind.AdditionalItems{Count: len(arr) - evaluated}) + } + case *Schema: + for i, item := range arr[evaluated:] { + vd.addErr(vd.validateVal(additional, item, strconv.Itoa(i))) + } + } + } + } else { + evaluated := minInt(len(s.PrefixItems), len(arr)) + + // prefixItems -- + for i, item := range arr[:evaluated] { + vd.addErr(vd.validateVal(s.PrefixItems[i], item, strconv.Itoa(i))) + } + + // items2020 -- + if s.Items2020 != nil { + for i, item := range arr[evaluated:] { + vd.addErr(vd.validateVal(s.Items2020, item, strconv.Itoa(i))) + } + } + } + + // contains -- + if s.Contains != nil { + var errors []*ValidationError + var matched []int + + for i, item := range arr { + if err := vd.validateVal(s.Contains, item, strconv.Itoa(i)); err != nil { + errors = append(errors, err.(*ValidationError)) + } else { + matched = append(matched, i) + if s.DraftVersion >= 2020 { + delete(vd.uneval.items, i) + } + } + } + + // minContains -- + if s.MinContains != nil { + if len(matched) < *s.MinContains { + vd.addErrors(errors, &kind.MinContains{Got: matched, Want: *s.MinContains}) + } + } else if len(matched) == 0 { + vd.addErrors(errors, &kind.Contains{}) + } + + // maxContains -- + if s.MaxContains != nil { + if len(matched) > *s.MaxContains { + vd.addError(&kind.MaxContains{Got: matched, Want: *s.MaxContains}) + } + } + } +} + +func (vd *validator) strValidate(str string) { + s := vd.sch + + strLen := -1 + if s.MinLength != nil || s.MaxLength != nil { + strLen = utf8.RuneCount([]byte(str)) + } + + // minLength -- + if s.MinLength != nil { + if strLen < *s.MinLength { + vd.addError(&kind.MinLength{Got: strLen, Want: *s.MinLength}) + } + } + + // maxLength -- + if s.MaxLength != nil { + if strLen > *s.MaxLength { + vd.addError(&kind.MaxLength{Got: strLen, Want: *s.MaxLength}) + } + } + + // pattern -- + if s.Pattern != nil { + if !s.Pattern.MatchString(str) { + vd.addError(&kind.Pattern{Got: str, Want: s.Pattern.String()}) + } + } + + if s.DraftVersion == 6 { + return + } + + var err error + + // contentEncoding -- + decoded := []byte(str) + if s.ContentEncoding != nil { + decoded, err = s.ContentEncoding.Decode(str) + if err != nil { + decoded = nil + vd.addError(&kind.ContentEncoding{Want: s.ContentEncoding.Name, Err: err}) + } + } + + var deserialized *any + if decoded != nil && s.ContentMediaType != nil { + if s.ContentSchema == nil { + err = s.ContentMediaType.Validate(decoded) + } else { + var value any + value, err = s.ContentMediaType.UnmarshalJSON(decoded) + if err == nil { + deserialized = &value + } + } + if err != nil { + vd.addError(&kind.ContentMediaType{ + Got: decoded, + Want: s.ContentMediaType.Name, + Err: err, + }) + } + } + + if deserialized != nil && s.ContentSchema != nil { + sch, meta, resources := s.ContentSchema, vd.meta, vd.resources + res := vd.metaResource(sch) + if res != nil { + meta = res.dialect.getSchema(vd.assertVocabs, vd.vocabularies) + sch = meta + } + if err = sch.validate(*deserialized, vd.regexpEngine, meta, resources, vd.assertVocabs, vd.vocabularies); err != nil { + verr := err.(*ValidationError) + verr.SchemaURL = s.Location + verr.ErrorKind = &kind.ContentSchema{} + vd.addErr(verr) + } + } +} + +func (vd *validator) numValidate(v any) { + s := vd.sch + + var numVal *big.Rat + num := func() *big.Rat { + if numVal == nil { + numVal, _ = new(big.Rat).SetString(fmt.Sprintf("%v", v)) + } + return numVal + } + + // minimum -- + if s.Minimum != nil && num().Cmp(s.Minimum) < 0 { + vd.addError(&kind.Minimum{Got: num(), Want: s.Minimum}) + } + + // maximum -- + if s.Maximum != nil && num().Cmp(s.Maximum) > 0 { + vd.addError(&kind.Maximum{Got: num(), Want: s.Maximum}) + } + + // exclusiveMinimum + if s.ExclusiveMinimum != nil && num().Cmp(s.ExclusiveMinimum) <= 0 { + vd.addError(&kind.ExclusiveMinimum{Got: num(), Want: s.ExclusiveMinimum}) + } + + // exclusiveMaximum + if s.ExclusiveMaximum != nil && num().Cmp(s.ExclusiveMaximum) >= 0 { + vd.addError(&kind.ExclusiveMaximum{Got: num(), Want: s.ExclusiveMaximum}) + } + + // multipleOf + if s.MultipleOf != nil { + if q := new(big.Rat).Quo(num(), s.MultipleOf); !q.IsInt() { + vd.addError(&kind.MultipleOf{Got: num(), Want: s.MultipleOf}) + } + } +} + +func (vd *validator) condValidate() { + s := vd.sch + + // not -- + if s.Not != nil { + if vd.validateSelf(s.Not, "", true) == nil { + vd.addError(&kind.Not{}) + } + } + + // allOf -- + if len(s.AllOf) > 0 { + var errors []*ValidationError + for _, sch := range s.AllOf { + if err := vd.validateSelf(sch, "", false); err != nil { + errors = append(errors, err.(*ValidationError)) + if vd.boolResult { + break + } + } + } + if len(errors) != 0 { + vd.addErrors(errors, &kind.AllOf{}) + } + } + + // anyOf + if len(s.AnyOf) > 0 { + var matched bool + var errors []*ValidationError + for _, sch := range s.AnyOf { + if err := vd.validateSelf(sch, "", false); err != nil { + errors = append(errors, err.(*ValidationError)) + } else { + matched = true + // for uneval, all schemas must be evaluated + if vd.uneval.isEmpty() { + break + } + } + } + if !matched { + vd.addErrors(errors, &kind.AnyOf{}) + } + } + + // oneOf + if len(s.OneOf) > 0 { + var matched = -1 + var errors []*ValidationError + for i, sch := range s.OneOf { + if err := vd.validateSelf(sch, "", matched != -1); err != nil { + if matched == -1 { + errors = append(errors, err.(*ValidationError)) + } + } else { + if matched == -1 { + matched = i + } else { + vd.addError(&kind.OneOf{Subschemas: []int{matched, i}}) + break + } + } + } + if matched == -1 { + vd.addErrors(errors, &kind.OneOf{Subschemas: nil}) + } + } + + // if, then, else -- + if s.If != nil { + if vd.validateSelf(s.If, "", true) == nil { + if s.Then != nil { + vd.addErr(vd.validateSelf(s.Then, "", false)) + } + } else if s.Else != nil { + vd.addErr(vd.validateSelf(s.Else, "", false)) + } + } +} + +func (vd *validator) unevalValidate() { + s := vd.sch + + // unevaluatedProperties + if obj, ok := vd.v.(map[string]any); ok && s.UnevaluatedProperties != nil { + for pname := range vd.uneval.props { + if pvalue, ok := obj[pname]; ok { + vd.addErr(vd.validateVal(s.UnevaluatedProperties, pvalue, pname)) + } + } + vd.uneval.props = nil + } + + // unevaluatedItems + if arr, ok := vd.v.([]any); ok && s.UnevaluatedItems != nil { + for i := range vd.uneval.items { + vd.addErr(vd.validateVal(s.UnevaluatedItems, arr[i], strconv.Itoa(i))) + } + vd.uneval.items = nil + } +} + +// validation helpers -- + +func (vd *validator) validateSelf(sch *Schema, refKw string, boolResult bool) error { + scp := vd.scp.child(sch, refKw, vd.scp.vid) + uneval := unevalFrom(vd.v, sch, !vd.uneval.isEmpty()) + subvd := validator{ + v: vd.v, + vloc: vd.vloc, + sch: sch, + scp: scp, + uneval: uneval, + errors: nil, + boolResult: vd.boolResult || boolResult, + regexpEngine: vd.regexpEngine, + meta: vd.meta, + resources: vd.resources, + assertVocabs: vd.assertVocabs, + vocabularies: vd.vocabularies, + } + subvd.handleMeta() + uneval, err := subvd.validate() + if err == nil { + vd.uneval.merge(uneval) + } + return err +} + +func (vd *validator) validateVal(sch *Schema, v any, vtok string) error { + vloc := append(vd.vloc, vtok) + scp := vd.scp.child(sch, "", vd.scp.vid+1) + uneval := unevalFrom(v, sch, false) + subvd := validator{ + v: v, + vloc: vloc, + sch: sch, + scp: scp, + uneval: uneval, + errors: nil, + boolResult: vd.boolResult, + regexpEngine: vd.regexpEngine, + meta: vd.meta, + resources: vd.resources, + assertVocabs: vd.assertVocabs, + vocabularies: vd.vocabularies, + } + subvd.handleMeta() + _, err := subvd.validate() + return err +} + +func (vd *validator) validateValue(sch *Schema, v any, vpath []string) error { + vloc := append(vd.vloc, vpath...) + scp := vd.scp.child(sch, "", vd.scp.vid+1) + uneval := unevalFrom(v, sch, false) + subvd := validator{ + v: v, + vloc: vloc, + sch: sch, + scp: scp, + uneval: uneval, + errors: nil, + boolResult: vd.boolResult, + regexpEngine: vd.regexpEngine, + meta: vd.meta, + resources: vd.resources, + assertVocabs: vd.assertVocabs, + vocabularies: vd.vocabularies, + } + subvd.handleMeta() + _, err := subvd.validate() + return err +} + +func (vd *validator) metaResource(sch *Schema) *resource { + if sch != vd.meta { + return nil + } + ptr := "" + for _, tok := range vd.instanceLocation() { + ptr += "/" + ptr += escape(tok) + } + return vd.resources[jsonPointer(ptr)] +} + +func (vd *validator) handleMeta() { + res := vd.metaResource(vd.sch) + if res == nil { + return + } + sch := res.dialect.getSchema(vd.assertVocabs, vd.vocabularies) + vd.meta = sch + vd.sch = sch +} + +// reference validation -- + +func (vd *validator) validateRef(sch *Schema, kw string) error { + err := vd.validateSelf(sch, kw, false) + if err != nil { + refErr := vd.error(&kind.Reference{Keyword: kw, URL: sch.Location}) + verr := err.(*ValidationError) + if _, ok := verr.ErrorKind.(*kind.Group); ok { + refErr.Causes = verr.Causes + } else { + refErr.Causes = append(refErr.Causes, verr) + } + return refErr + } + return nil +} + +func (vd *validator) resolveRecursiveAnchor(fallback *Schema) *Schema { + sch := fallback + scp := vd.scp + for scp != nil { + if scp.sch.resource.RecursiveAnchor { + sch = scp.sch + } + scp = scp.parent + } + return sch +} + +func (vd *validator) resolveDynamicAnchor(name string, fallback *Schema) *Schema { + sch := fallback + scp := vd.scp + for scp != nil { + if dsch, ok := scp.sch.resource.dynamicAnchors[name]; ok { + sch = dsch + } + scp = scp.parent + } + return sch +} + +func (vd *validator) validateRefs() { + // $recursiveRef -- + if sch := vd.sch.RecursiveRef; sch != nil { + if sch.RecursiveAnchor { + sch = vd.resolveRecursiveAnchor(sch) + } + vd.addErr(vd.validateRef(sch, "$recursiveRef")) + } + + // $dynamicRef -- + if dref := vd.sch.DynamicRef; dref != nil { + sch := dref.Ref // initial target + if dref.Anchor != "" { + // $dynamicRef includes anchor + if sch.DynamicAnchor == dref.Anchor { + // initial target has matching $dynamicAnchor + sch = vd.resolveDynamicAnchor(dref.Anchor, sch) + } + } + vd.addErr(vd.validateRef(sch, "$dynamicRef")) + } +} + +// error helpers -- + +func (vd *validator) instanceLocation() []string { + return slices.Clone(vd.vloc) +} + +func (vd *validator) error(kind ErrorKind) *ValidationError { + if vd.boolResult { + return &ValidationError{} + } + return &ValidationError{ + SchemaURL: vd.sch.Location, + InstanceLocation: vd.instanceLocation(), + ErrorKind: kind, + Causes: nil, + } +} + +func (vd *validator) addErr(err error) { + if err != nil { + vd.errors = append(vd.errors, err.(*ValidationError)) + } +} + +func (vd *validator) addError(kind ErrorKind) { + vd.errors = append(vd.errors, vd.error(kind)) +} + +func (vd *validator) addErrors(errors []*ValidationError, kind ErrorKind) { + err := vd.error(kind) + err.Causes = errors + vd.errors = append(vd.errors, err) +} + +func (vd *validator) findMissing(obj map[string]any, reqd []string) []string { + var missing []string + for _, pname := range reqd { + if _, ok := obj[pname]; !ok { + if vd.boolResult { + return []string{} // non-nil + } + missing = append(missing, pname) + } + } + return missing +} + +// -- + +type scope struct { + sch *Schema + + // if empty, compute from self.sch and self.parent.sch. + // not empty, only when there is a jump i.e, $ref, $XXXRef + refKeyword string + + // unique id of value being validated + // if two scopes validate same value, they will have + // same vid + vid int + + parent *scope +} + +func (sc *scope) child(sch *Schema, refKeyword string, vid int) *scope { + return &scope{sch, refKeyword, vid, sc} +} + +func (sc *scope) checkCycle() *scope { + scp := sc.parent + for scp != nil { + if scp.vid != sc.vid { + break + } + if scp.sch == sc.sch { + return scp + } + scp = scp.parent + } + return nil +} + +func (sc *scope) kwLoc() string { + var loc string + for sc.parent != nil { + if sc.refKeyword != "" { + loc = fmt.Sprintf("/%s%s", escape(sc.refKeyword), loc) + } else { + cur := sc.sch.Location + parent := sc.parent.sch.Location + loc = fmt.Sprintf("%s%s", cur[len(parent):], loc) + } + sc = sc.parent + } + return loc +} + +// -- + +type uneval struct { + props map[string]struct{} + items map[int]struct{} +} + +func unevalFrom(v any, sch *Schema, callerNeeds bool) *uneval { + uneval := &uneval{} + switch v := v.(type) { + case map[string]any: + if !sch.allPropsEvaluated && (callerNeeds || sch.UnevaluatedProperties != nil) { + uneval.props = map[string]struct{}{} + for k := range v { + uneval.props[k] = struct{}{} + } + } + case []any: + if !sch.allItemsEvaluated && (callerNeeds || sch.UnevaluatedItems != nil) && sch.numItemsEvaluated < len(v) { + uneval.items = map[int]struct{}{} + for i := sch.numItemsEvaluated; i < len(v); i++ { + uneval.items[i] = struct{}{} + } + } + } + return uneval +} + +func (ue *uneval) merge(other *uneval) { + for k := range ue.props { + if _, ok := other.props[k]; !ok { + delete(ue.props, k) + } + } + for i := range ue.items { + if _, ok := other.items[i]; !ok { + delete(ue.items, i) + } + } +} + +func (ue *uneval) isEmpty() bool { + return len(ue.props) == 0 && len(ue.items) == 0 +} + +// -- + +type ValidationError struct { + // absolute, dereferenced schema location. + SchemaURL string + + // location of the JSON value within the instance being validated. + InstanceLocation []string + + // kind of error + ErrorKind ErrorKind + + // holds nested errors + Causes []*ValidationError +} + +type ErrorKind interface { + KeywordPath() []string + LocalizedString(*message.Printer) string +} diff --git a/vendor/github.com/santhosh-tekuri/jsonschema/v6/vocab.go b/vendor/github.com/santhosh-tekuri/jsonschema/v6/vocab.go new file mode 100644 index 0000000..c81cb70 --- /dev/null +++ b/vendor/github.com/santhosh-tekuri/jsonschema/v6/vocab.go @@ -0,0 +1,111 @@ +package jsonschema + +// CompilerContext provides helpers for +// compiling a [Vocabulary]. +type CompilerContext struct { + c *objCompiler +} + +func (ctx *CompilerContext) Enqueue(schPath []string) *Schema { + ptr := ctx.c.up.ptr + for _, tok := range schPath { + ptr = ptr.append(tok) + } + return ctx.c.enqueuePtr(ptr) +} + +// Vocabulary defines a set of keywords, their syntax and +// their semantics. +type Vocabulary struct { + // URL identifier for this Vocabulary. + URL string + + // Schema that is used to validate the keywords that is introduced by this + // vocabulary. + Schema *Schema + + // Subschemas lists the possible locations of subschemas introduced by + // this vocabulary. + Subschemas []SchemaPath + + // Compile compiles the keywords(introduced by this vocabulary) in obj into [SchemaExt]. + // If obj does not contain any keywords introduced by this vocabulary, nil SchemaExt must + // be returned. + Compile func(ctx *CompilerContext, obj map[string]any) (SchemaExt, error) +} + +// -- + +// SchemaExt is compled form of vocabulary. +type SchemaExt interface { + // Validate validates v against and errors if any are reported + // to ctx. + Validate(ctx *ValidatorContext, v any) +} + +// ValidatorContext provides helpers for +// validating with [SchemaExt]. +type ValidatorContext struct { + vd *validator +} + +// ValueLocation returns location of value as jsonpath token array. +func (ctx *ValidatorContext) ValueLocation() []string { + return ctx.vd.vloc +} + +// Validate validates v with sch. vpath gives path of v from current context value. +func (ctx *ValidatorContext) Validate(sch *Schema, v any, vpath []string) error { + switch len(vpath) { + case 0: + return ctx.vd.validateSelf(sch, "", false) + case 1: + return ctx.vd.validateVal(sch, v, vpath[0]) + default: + return ctx.vd.validateValue(sch, v, vpath) + } +} + +// EvaluatedProp marks given property of current object as evaluated. +func (ctx *ValidatorContext) EvaluatedProp(pname string) { + delete(ctx.vd.uneval.props, pname) +} + +// EvaluatedItem marks items at given index of current array as evaluated. +func (ctx *ValidatorContext) EvaluatedItem(index int) { + delete(ctx.vd.uneval.items, index) +} + +// AddError reports validation-error of given kind. +func (ctx *ValidatorContext) AddError(k ErrorKind) { + ctx.vd.addError(k) +} + +// AddErrors reports validation-errors of given kind. +func (ctx *ValidatorContext) AddErrors(errors []*ValidationError, k ErrorKind) { + ctx.vd.addErrors(errors, k) +} + +// AddErr reports the given err. This is typically used to report +// the error created by subschema validation. +// +// NOTE that err must be of type *ValidationError. +func (ctx *ValidatorContext) AddErr(err error) { + ctx.vd.addErr(err) +} + +func (ctx *ValidatorContext) Equals(v1, v2 any) (bool, error) { + b, k := equals(v1, v2) + if k != nil { + return false, ctx.vd.error(k) + } + return b, nil +} + +func (ctx *ValidatorContext) Duplicates(arr []any) (int, int, error) { + i, j, k := duplicates(arr) + if k != nil { + return -1, -1, ctx.vd.error(k) + } + return i, j, nil +} diff --git a/vendor/golang.org/x/text/feature/plural/common.go b/vendor/golang.org/x/text/feature/plural/common.go new file mode 100644 index 0000000..fdcb373 --- /dev/null +++ b/vendor/golang.org/x/text/feature/plural/common.go @@ -0,0 +1,70 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package plural + +// Form defines a plural form. +// +// Not all languages support all forms. Also, the meaning of each form varies +// per language. It is important to note that the name of a form does not +// necessarily correspond one-to-one with the set of numbers. For instance, +// for Croation, One matches not only 1, but also 11, 21, etc. +// +// Each language must at least support the form "other". +type Form byte + +const ( + Other Form = iota + Zero + One + Two + Few + Many +) + +var countMap = map[string]Form{ + "other": Other, + "zero": Zero, + "one": One, + "two": Two, + "few": Few, + "many": Many, +} + +type pluralCheck struct { + // category: + // 3..7: opID + // 0..2: category + cat byte + setID byte +} + +// opID identifies the type of operand in the plural rule, being i, n or f. +// (v, w, and t are treated as filters in our implementation.) +type opID byte + +const ( + opMod opID = 0x1 // is '%' used? + opNotEqual opID = 0x2 // using "!=" to compare + opI opID = 0 << 2 // integers after taking the absolute value + opN opID = 1 << 2 // full number (must be integer) + opF opID = 2 << 2 // fraction + opV opID = 3 << 2 // number of visible digits + opW opID = 4 << 2 // number of visible digits without trailing zeros + opBretonM opID = 5 << 2 // hard-wired rule for Breton + opItalian800 opID = 6 << 2 // hard-wired rule for Italian + opAzerbaijan00s opID = 7 << 2 // hard-wired rule for Azerbaijan +) +const ( + // Use this plural form to indicate the next rule needs to match as well. + // The last condition in the list will have the correct plural form. + andNext = 0x7 + formMask = 0x7 + + opShift = 3 + + // numN indicates the maximum integer, or maximum mod value, for which we + // have inclusion masks. + numN = 100 + // The common denominator of the modulo that is taken. + maxMod = 100 +) diff --git a/vendor/golang.org/x/text/feature/plural/message.go b/vendor/golang.org/x/text/feature/plural/message.go new file mode 100644 index 0000000..56d518c --- /dev/null +++ b/vendor/golang.org/x/text/feature/plural/message.go @@ -0,0 +1,244 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package plural + +import ( + "fmt" + "io" + "reflect" + "strconv" + + "golang.org/x/text/internal/catmsg" + "golang.org/x/text/internal/number" + "golang.org/x/text/language" + "golang.org/x/text/message/catalog" +) + +// TODO: consider deleting this interface. Maybe VisibleDigits is always +// sufficient and practical. + +// Interface is used for types that can determine their own plural form. +type Interface interface { + // PluralForm reports the plural form for the given language of the + // underlying value. It also returns the integer value. If the integer value + // is larger than fits in n, PluralForm may return a value modulo + // 10,000,000. + PluralForm(t language.Tag, scale int) (f Form, n int) +} + +// Selectf returns the first case for which its selector is a match for the +// arg-th substitution argument to a formatting call, formatting it as indicated +// by format. +// +// The cases argument are pairs of selectors and messages. Selectors are of type +// string or Form. Messages are of type string or catalog.Message. A selector +// matches an argument if: +// - it is "other" or Other +// - it matches the plural form of the argument: "zero", "one", "two", "few", +// or "many", or the equivalent Form +// - it is of the form "=x" where x is an integer that matches the value of +// the argument. +// - it is of the form " kindDefault { + e.EncodeUint(uint64(m.scale)) + } + + forms := validForms(cardinal, e.Language()) + + for i := 0; i < len(m.cases); { + if err := compileSelector(e, forms, m.cases[i]); err != nil { + return err + } + if i++; i >= len(m.cases) { + return fmt.Errorf("plural: no message defined for selector %v", m.cases[i-1]) + } + var msg catalog.Message + switch x := m.cases[i].(type) { + case string: + msg = catalog.String(x) + case catalog.Message: + msg = x + default: + return fmt.Errorf("plural: message of type %T; must be string or catalog.Message", x) + } + if err := e.EncodeMessage(msg); err != nil { + return err + } + i++ + } + return nil +} + +func compileSelector(e *catmsg.Encoder, valid []Form, selector interface{}) error { + form := Other + switch x := selector.(type) { + case string: + if x == "" { + return fmt.Errorf("plural: empty selector") + } + if c := x[0]; c == '=' || c == '<' { + val, err := strconv.ParseUint(x[1:], 10, 16) + if err != nil { + return fmt.Errorf("plural: invalid number in selector %q: %v", selector, err) + } + e.EncodeUint(uint64(c)) + e.EncodeUint(val) + return nil + } + var ok bool + form, ok = countMap[x] + if !ok { + return fmt.Errorf("plural: invalid plural form %q", selector) + } + case Form: + form = x + default: + return fmt.Errorf("plural: selector of type %T; want string or Form", selector) + } + + ok := false + for _, f := range valid { + if f == form { + ok = true + break + } + } + if !ok { + return fmt.Errorf("plural: form %q not supported for language %q", selector, e.Language()) + } + e.EncodeUint(uint64(form)) + return nil +} + +func execute(d *catmsg.Decoder) bool { + lang := d.Language() + argN := int(d.DecodeUint()) + kind := int(d.DecodeUint()) + scale := -1 // default + if kind > kindDefault { + scale = int(d.DecodeUint()) + } + form := Other + n := -1 + if arg := d.Arg(argN); arg == nil { + // Default to Other. + } else if x, ok := arg.(number.VisibleDigits); ok { + d := x.Digits(nil, lang, scale) + form, n = cardinal.matchDisplayDigits(lang, &d) + } else if x, ok := arg.(Interface); ok { + // This covers lists and formatters from the number package. + form, n = x.PluralForm(lang, scale) + } else { + var f number.Formatter + switch kind { + case kindScale: + f.InitDecimal(lang) + f.SetScale(scale) + case kindScientific: + f.InitScientific(lang) + f.SetScale(scale) + case kindPrecision: + f.InitDecimal(lang) + f.SetPrecision(scale) + case kindDefault: + // sensible default + f.InitDecimal(lang) + if k := reflect.TypeOf(arg).Kind(); reflect.Int <= k && k <= reflect.Uintptr { + f.SetScale(0) + } else { + f.SetScale(2) + } + } + var dec number.Decimal // TODO: buffer in Printer + dec.Convert(f.RoundingContext, arg) + v := number.FormatDigits(&dec, f.RoundingContext) + if !v.NaN && !v.Inf { + form, n = cardinal.matchDisplayDigits(d.Language(), &v) + } + } + for !d.Done() { + f := d.DecodeUint() + if (f == '=' && n == int(d.DecodeUint())) || + (f == '<' && 0 <= n && n < int(d.DecodeUint())) || + form == Form(f) || + Other == Form(f) { + return d.ExecuteMessage() + } + d.SkipMessage() + } + return false +} diff --git a/vendor/golang.org/x/text/feature/plural/plural.go b/vendor/golang.org/x/text/feature/plural/plural.go new file mode 100644 index 0000000..e9f2d42 --- /dev/null +++ b/vendor/golang.org/x/text/feature/plural/plural.go @@ -0,0 +1,262 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_common.go + +// Package plural provides utilities for handling linguistic plurals in text. +// +// The definitions in this package are based on the plural rule handling defined +// in CLDR. See +// https://unicode.org/reports/tr35/tr35-numbers.html#Language_Plural_Rules for +// details. +package plural + +import ( + "golang.org/x/text/internal/language/compact" + "golang.org/x/text/internal/number" + "golang.org/x/text/language" +) + +// Rules defines the plural rules for all languages for a certain plural type. +// +// This package is UNDER CONSTRUCTION and its API may change. +type Rules struct { + rules []pluralCheck + index []byte + langToIndex []byte + inclusionMasks []uint64 +} + +var ( + // Cardinal defines the plural rules for numbers indicating quantities. + Cardinal *Rules = cardinal + + // Ordinal defines the plural rules for numbers indicating position + // (first, second, etc.). + Ordinal *Rules = ordinal + + ordinal = &Rules{ + ordinalRules, + ordinalIndex, + ordinalLangToIndex, + ordinalInclusionMasks[:], + } + + cardinal = &Rules{ + cardinalRules, + cardinalIndex, + cardinalLangToIndex, + cardinalInclusionMasks[:], + } +) + +// getIntApprox converts the digits in slice digits[start:end] to an integer +// according to the following rules: +// - Let i be asInt(digits[start:end]), where out-of-range digits are assumed +// to be zero. +// - Result n is big if i / 10^nMod > 1. +// - Otherwise the result is i % 10^nMod. +// +// For example, if digits is {1, 2, 3} and start:end is 0:5, then the result +// for various values of nMod is: +// - when nMod == 2, n == big +// - when nMod == 3, n == big +// - when nMod == 4, n == big +// - when nMod == 5, n == 12300 +// - when nMod == 6, n == 12300 +// - when nMod == 7, n == 12300 +func getIntApprox(digits []byte, start, end, nMod, big int) (n int) { + // Leading 0 digits just result in 0. + p := start + if p < 0 { + p = 0 + } + // Range only over the part for which we have digits. + mid := end + if mid >= len(digits) { + mid = len(digits) + } + // Check digits more significant that nMod. + if q := end - nMod; q > 0 { + if q > mid { + q = mid + } + for ; p < q; p++ { + if digits[p] != 0 { + return big + } + } + } + for ; p < mid; p++ { + n = 10*n + int(digits[p]) + } + // Multiply for trailing zeros. + for ; p < end; p++ { + n *= 10 + } + return n +} + +// MatchDigits computes the plural form for the given language and the given +// decimal floating point digits. The digits are stored in big-endian order and +// are of value byte(0) - byte(9). The floating point position is indicated by +// exp and the number of visible decimals is scale. All leading and trailing +// zeros may be omitted from digits. +// +// The following table contains examples of possible arguments to represent +// the given numbers. +// +// decimal digits exp scale +// 123 []byte{1, 2, 3} 3 0 +// 123.4 []byte{1, 2, 3, 4} 3 1 +// 123.40 []byte{1, 2, 3, 4} 3 2 +// 100000 []byte{1} 6 0 +// 100000.00 []byte{1} 6 3 +func (p *Rules) MatchDigits(t language.Tag, digits []byte, exp, scale int) Form { + index := tagToID(t) + + // Differentiate up to including mod 1000000 for the integer part. + n := getIntApprox(digits, 0, exp, 6, 1000000) + + // Differentiate up to including mod 100 for the fractional part. + f := getIntApprox(digits, exp, exp+scale, 2, 100) + + return matchPlural(p, index, n, f, scale) +} + +func (p *Rules) matchDisplayDigits(t language.Tag, d *number.Digits) (Form, int) { + n := getIntApprox(d.Digits, 0, int(d.Exp), 6, 1000000) + return p.MatchDigits(t, d.Digits, int(d.Exp), d.NumFracDigits()), n +} + +func validForms(p *Rules, t language.Tag) (forms []Form) { + offset := p.langToIndex[tagToID(t)] + rules := p.rules[p.index[offset]:p.index[offset+1]] + + forms = append(forms, Other) + last := Other + for _, r := range rules { + if cat := Form(r.cat & formMask); cat != andNext && last != cat { + forms = append(forms, cat) + last = cat + } + } + return forms +} + +func (p *Rules) matchComponents(t language.Tag, n, f, scale int) Form { + return matchPlural(p, tagToID(t), n, f, scale) +} + +// MatchPlural returns the plural form for the given language and plural +// operands (as defined in +// https://unicode.org/reports/tr35/tr35-numbers.html#Language_Plural_Rules): +// +// where +// n absolute value of the source number (integer and decimals) +// input +// i integer digits of n. +// v number of visible fraction digits in n, with trailing zeros. +// w number of visible fraction digits in n, without trailing zeros. +// f visible fractional digits in n, with trailing zeros (f = t * 10^(v-w)) +// t visible fractional digits in n, without trailing zeros. +// +// If any of the operand values is too large to fit in an int, it is okay to +// pass the value modulo 10,000,000. +func (p *Rules) MatchPlural(lang language.Tag, i, v, w, f, t int) Form { + return matchPlural(p, tagToID(lang), i, f, v) +} + +func matchPlural(p *Rules, index compact.ID, n, f, v int) Form { + nMask := p.inclusionMasks[n%maxMod] + // Compute the fMask inline in the rules below, as it is relatively rare. + // fMask := p.inclusionMasks[f%maxMod] + vMask := p.inclusionMasks[v%maxMod] + + // Do the matching + offset := p.langToIndex[index] + rules := p.rules[p.index[offset]:p.index[offset+1]] + for i := 0; i < len(rules); i++ { + rule := rules[i] + setBit := uint64(1 << rule.setID) + var skip bool + switch op := opID(rule.cat >> opShift); op { + case opI: // i = x + skip = n >= numN || nMask&setBit == 0 + + case opI | opNotEqual: // i != x + skip = n < numN && nMask&setBit != 0 + + case opI | opMod: // i % m = x + skip = nMask&setBit == 0 + + case opI | opMod | opNotEqual: // i % m != x + skip = nMask&setBit != 0 + + case opN: // n = x + skip = f != 0 || n >= numN || nMask&setBit == 0 + + case opN | opNotEqual: // n != x + skip = f == 0 && n < numN && nMask&setBit != 0 + + case opN | opMod: // n % m = x + skip = f != 0 || nMask&setBit == 0 + + case opN | opMod | opNotEqual: // n % m != x + skip = f == 0 && nMask&setBit != 0 + + case opF: // f = x + skip = f >= numN || p.inclusionMasks[f%maxMod]&setBit == 0 + + case opF | opNotEqual: // f != x + skip = f < numN && p.inclusionMasks[f%maxMod]&setBit != 0 + + case opF | opMod: // f % m = x + skip = p.inclusionMasks[f%maxMod]&setBit == 0 + + case opF | opMod | opNotEqual: // f % m != x + skip = p.inclusionMasks[f%maxMod]&setBit != 0 + + case opV: // v = x + skip = v < numN && vMask&setBit == 0 + + case opV | opNotEqual: // v != x + skip = v < numN && vMask&setBit != 0 + + case opW: // w == 0 + skip = f != 0 + + case opW | opNotEqual: // w != 0 + skip = f == 0 + + // Hard-wired rules that cannot be handled by our algorithm. + + case opBretonM: + skip = f != 0 || n == 0 || n%1000000 != 0 + + case opAzerbaijan00s: + // 100,200,300,400,500,600,700,800,900 + skip = n == 0 || n >= 1000 || n%100 != 0 + + case opItalian800: + skip = (f != 0 || n >= numN || nMask&setBit == 0) && n != 800 + } + if skip { + // advance over AND entries. + for ; i < len(rules) && rules[i].cat&formMask == andNext; i++ { + } + continue + } + // return if we have a final entry. + if cat := rule.cat & formMask; cat != andNext { + return Form(cat) + } + } + return Other +} + +func tagToID(t language.Tag) compact.ID { + id, _ := compact.RegionalID(compact.Tag(t)) + return id +} diff --git a/vendor/golang.org/x/text/feature/plural/tables.go b/vendor/golang.org/x/text/feature/plural/tables.go new file mode 100644 index 0000000..b06b9cb --- /dev/null +++ b/vendor/golang.org/x/text/feature/plural/tables.go @@ -0,0 +1,552 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package plural + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +var ordinalRules = []pluralCheck{ // 64 elements + 0: {cat: 0x2f, setID: 0x4}, + 1: {cat: 0x3a, setID: 0x5}, + 2: {cat: 0x22, setID: 0x1}, + 3: {cat: 0x22, setID: 0x6}, + 4: {cat: 0x22, setID: 0x7}, + 5: {cat: 0x2f, setID: 0x8}, + 6: {cat: 0x3c, setID: 0x9}, + 7: {cat: 0x2f, setID: 0xa}, + 8: {cat: 0x3c, setID: 0xb}, + 9: {cat: 0x2c, setID: 0xc}, + 10: {cat: 0x24, setID: 0xd}, + 11: {cat: 0x2d, setID: 0xe}, + 12: {cat: 0x2d, setID: 0xf}, + 13: {cat: 0x2f, setID: 0x10}, + 14: {cat: 0x35, setID: 0x3}, + 15: {cat: 0xc5, setID: 0x11}, + 16: {cat: 0x2, setID: 0x1}, + 17: {cat: 0x5, setID: 0x3}, + 18: {cat: 0xd, setID: 0x12}, + 19: {cat: 0x22, setID: 0x1}, + 20: {cat: 0x2f, setID: 0x13}, + 21: {cat: 0x3d, setID: 0x14}, + 22: {cat: 0x2f, setID: 0x15}, + 23: {cat: 0x3a, setID: 0x16}, + 24: {cat: 0x2f, setID: 0x17}, + 25: {cat: 0x3b, setID: 0x18}, + 26: {cat: 0x2f, setID: 0xa}, + 27: {cat: 0x3c, setID: 0xb}, + 28: {cat: 0x22, setID: 0x1}, + 29: {cat: 0x23, setID: 0x19}, + 30: {cat: 0x24, setID: 0x1a}, + 31: {cat: 0x22, setID: 0x1b}, + 32: {cat: 0x23, setID: 0x2}, + 33: {cat: 0x24, setID: 0x1a}, + 34: {cat: 0xf, setID: 0x15}, + 35: {cat: 0x1a, setID: 0x16}, + 36: {cat: 0xf, setID: 0x17}, + 37: {cat: 0x1b, setID: 0x18}, + 38: {cat: 0xf, setID: 0x1c}, + 39: {cat: 0x1d, setID: 0x1d}, + 40: {cat: 0xa, setID: 0x1e}, + 41: {cat: 0xa, setID: 0x1f}, + 42: {cat: 0xc, setID: 0x20}, + 43: {cat: 0xe4, setID: 0x0}, + 44: {cat: 0x5, setID: 0x3}, + 45: {cat: 0xd, setID: 0xe}, + 46: {cat: 0xd, setID: 0x21}, + 47: {cat: 0x22, setID: 0x1}, + 48: {cat: 0x23, setID: 0x19}, + 49: {cat: 0x24, setID: 0x1a}, + 50: {cat: 0x25, setID: 0x22}, + 51: {cat: 0x22, setID: 0x23}, + 52: {cat: 0x23, setID: 0x19}, + 53: {cat: 0x24, setID: 0x1a}, + 54: {cat: 0x25, setID: 0x22}, + 55: {cat: 0x22, setID: 0x24}, + 56: {cat: 0x23, setID: 0x19}, + 57: {cat: 0x24, setID: 0x1a}, + 58: {cat: 0x25, setID: 0x22}, + 59: {cat: 0x21, setID: 0x25}, + 60: {cat: 0x22, setID: 0x1}, + 61: {cat: 0x23, setID: 0x2}, + 62: {cat: 0x24, setID: 0x26}, + 63: {cat: 0x25, setID: 0x27}, +} // Size: 152 bytes + +var ordinalIndex = []uint8{ // 22 elements + 0x00, 0x00, 0x02, 0x03, 0x04, 0x05, 0x07, 0x09, + 0x0b, 0x0f, 0x10, 0x13, 0x16, 0x1c, 0x1f, 0x22, + 0x28, 0x2f, 0x33, 0x37, 0x3b, 0x40, +} // Size: 46 bytes + +var ordinalLangToIndex = []uint8{ // 775 elements + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x12, 0x12, 0x00, 0x00, 0x00, 0x00, 0x10, 0x10, + 0x10, 0x10, 0x10, 0x00, 0x00, 0x05, 0x05, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 40 - 7F + 0x12, 0x12, 0x12, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, + 0x0e, 0x0e, 0x0e, 0x0e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x14, 0x14, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 80 - BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x0c, + 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, + 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, + 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, + 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, + 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, + 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, + 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, + // Entry C0 - FF + 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, + 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, + 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, + 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, + 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, + 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 100 - 13F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x02, + 0x00, 0x00, 0x00, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 140 - 17F + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x00, 0x00, 0x00, 0x00, 0x02, 0x02, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x11, 0x11, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x11, + 0x11, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x03, + 0x02, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 180 - 1BF + 0x00, 0x00, 0x00, 0x00, 0x09, 0x09, 0x09, 0x09, + 0x09, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x0a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x08, 0x08, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x02, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x0f, 0x0f, 0x00, 0x00, + 0x00, 0x00, 0x02, 0x0d, 0x0d, 0x02, 0x02, 0x02, + 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 200 - 23F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x13, 0x13, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 240 - 27F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, + 0x02, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 280 - 2BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x0b, 0x0b, 0x0b, 0x0b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x01, 0x01, 0x01, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x07, 0x07, 0x02, 0x00, 0x00, 0x00, 0x00, + // Entry 2C0 - 2FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x02, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 300 - 33F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x0c, +} // Size: 799 bytes + +var ordinalInclusionMasks = []uint64{ // 100 elements + // Entry 0 - 1F + 0x0000002000010009, 0x00000018482000d3, 0x0000000042840195, 0x000000410a040581, + 0x00000041040c0081, 0x0000009840040041, 0x0000008400045001, 0x0000003850040001, + 0x0000003850060001, 0x0000003800049001, 0x0000000800052001, 0x0000000040660031, + 0x0000000041840331, 0x0000000100040f01, 0x00000001001c0001, 0x0000000040040001, + 0x0000000000045001, 0x0000000070040001, 0x0000000070040001, 0x0000000000049001, + 0x0000000080050001, 0x0000000040200011, 0x0000000040800111, 0x0000000100000501, + 0x0000000100080001, 0x0000000040000001, 0x0000000000005001, 0x0000000050000001, + 0x0000000050000001, 0x0000000000009001, 0x0000000000010001, 0x0000000040200011, + // Entry 20 - 3F + 0x0000000040800111, 0x0000000100000501, 0x0000000100080001, 0x0000000040000001, + 0x0000000000005001, 0x0000000050000001, 0x0000000050000001, 0x0000000000009001, + 0x0000000200050001, 0x0000000040200011, 0x0000000040800111, 0x0000000100000501, + 0x0000000100080001, 0x0000000040000001, 0x0000000000005001, 0x0000000050000001, + 0x0000000050000001, 0x0000000000009001, 0x0000000080010001, 0x0000000040200011, + 0x0000000040800111, 0x0000000100000501, 0x0000000100080001, 0x0000000040000001, + 0x0000000000005001, 0x0000000050000001, 0x0000000050000001, 0x0000000000009001, + 0x0000000200050001, 0x0000000040200011, 0x0000000040800111, 0x0000000100000501, + // Entry 40 - 5F + 0x0000000100080001, 0x0000000040000001, 0x0000000000005001, 0x0000000050000001, + 0x0000000050000001, 0x0000000000009001, 0x0000000080010001, 0x0000000040200011, + 0x0000000040800111, 0x0000000100000501, 0x0000000100080001, 0x0000000040000001, + 0x0000000000005001, 0x0000000050000001, 0x0000000050000001, 0x0000000000009001, + 0x0000000080070001, 0x0000000040200011, 0x0000000040800111, 0x0000000100000501, + 0x0000000100080001, 0x0000000040000001, 0x0000000000005001, 0x0000000050000001, + 0x0000000050000001, 0x0000000000009001, 0x0000000200010001, 0x0000000040200011, + 0x0000000040800111, 0x0000000100000501, 0x0000000100080001, 0x0000000040000001, + // Entry 60 - 7F + 0x0000000000005001, 0x0000000050000001, 0x0000000050000001, 0x0000000000009001, +} // Size: 824 bytes + +// Slots used for ordinal: 40 of 0xFF rules; 16 of 0xFF indexes; 40 of 64 sets + +var cardinalRules = []pluralCheck{ // 166 elements + 0: {cat: 0x2, setID: 0x3}, + 1: {cat: 0x22, setID: 0x1}, + 2: {cat: 0x2, setID: 0x4}, + 3: {cat: 0x2, setID: 0x4}, + 4: {cat: 0x7, setID: 0x1}, + 5: {cat: 0x62, setID: 0x3}, + 6: {cat: 0x22, setID: 0x4}, + 7: {cat: 0x7, setID: 0x3}, + 8: {cat: 0x42, setID: 0x1}, + 9: {cat: 0x22, setID: 0x4}, + 10: {cat: 0x22, setID: 0x4}, + 11: {cat: 0x22, setID: 0x5}, + 12: {cat: 0x22, setID: 0x1}, + 13: {cat: 0x22, setID: 0x1}, + 14: {cat: 0x7, setID: 0x4}, + 15: {cat: 0x92, setID: 0x3}, + 16: {cat: 0xf, setID: 0x6}, + 17: {cat: 0x1f, setID: 0x7}, + 18: {cat: 0x82, setID: 0x3}, + 19: {cat: 0x92, setID: 0x3}, + 20: {cat: 0xf, setID: 0x6}, + 21: {cat: 0x62, setID: 0x3}, + 22: {cat: 0x4a, setID: 0x6}, + 23: {cat: 0x7, setID: 0x8}, + 24: {cat: 0x62, setID: 0x3}, + 25: {cat: 0x1f, setID: 0x9}, + 26: {cat: 0x62, setID: 0x3}, + 27: {cat: 0x5f, setID: 0x9}, + 28: {cat: 0x72, setID: 0x3}, + 29: {cat: 0x29, setID: 0xa}, + 30: {cat: 0x29, setID: 0xb}, + 31: {cat: 0x4f, setID: 0xb}, + 32: {cat: 0x61, setID: 0x2}, + 33: {cat: 0x2f, setID: 0x6}, + 34: {cat: 0x3a, setID: 0x7}, + 35: {cat: 0x4f, setID: 0x6}, + 36: {cat: 0x5f, setID: 0x7}, + 37: {cat: 0x62, setID: 0x2}, + 38: {cat: 0x4f, setID: 0x6}, + 39: {cat: 0x72, setID: 0x2}, + 40: {cat: 0x21, setID: 0x3}, + 41: {cat: 0x7, setID: 0x4}, + 42: {cat: 0x32, setID: 0x3}, + 43: {cat: 0x21, setID: 0x3}, + 44: {cat: 0x22, setID: 0x1}, + 45: {cat: 0x22, setID: 0x1}, + 46: {cat: 0x23, setID: 0x2}, + 47: {cat: 0x2, setID: 0x3}, + 48: {cat: 0x22, setID: 0x1}, + 49: {cat: 0x24, setID: 0xc}, + 50: {cat: 0x7, setID: 0x1}, + 51: {cat: 0x62, setID: 0x3}, + 52: {cat: 0x74, setID: 0x3}, + 53: {cat: 0x24, setID: 0x3}, + 54: {cat: 0x2f, setID: 0xd}, + 55: {cat: 0x34, setID: 0x1}, + 56: {cat: 0xf, setID: 0x6}, + 57: {cat: 0x1f, setID: 0x7}, + 58: {cat: 0x62, setID: 0x3}, + 59: {cat: 0x4f, setID: 0x6}, + 60: {cat: 0x5a, setID: 0x7}, + 61: {cat: 0xf, setID: 0xe}, + 62: {cat: 0x1f, setID: 0xf}, + 63: {cat: 0x64, setID: 0x3}, + 64: {cat: 0x4f, setID: 0xe}, + 65: {cat: 0x5c, setID: 0xf}, + 66: {cat: 0x22, setID: 0x10}, + 67: {cat: 0x23, setID: 0x11}, + 68: {cat: 0x24, setID: 0x12}, + 69: {cat: 0xf, setID: 0x1}, + 70: {cat: 0x62, setID: 0x3}, + 71: {cat: 0xf, setID: 0x2}, + 72: {cat: 0x63, setID: 0x3}, + 73: {cat: 0xf, setID: 0x13}, + 74: {cat: 0x64, setID: 0x3}, + 75: {cat: 0x74, setID: 0x3}, + 76: {cat: 0xf, setID: 0x1}, + 77: {cat: 0x62, setID: 0x3}, + 78: {cat: 0x4a, setID: 0x1}, + 79: {cat: 0xf, setID: 0x2}, + 80: {cat: 0x63, setID: 0x3}, + 81: {cat: 0x4b, setID: 0x2}, + 82: {cat: 0xf, setID: 0x13}, + 83: {cat: 0x64, setID: 0x3}, + 84: {cat: 0x4c, setID: 0x13}, + 85: {cat: 0x7, setID: 0x1}, + 86: {cat: 0x62, setID: 0x3}, + 87: {cat: 0x7, setID: 0x2}, + 88: {cat: 0x63, setID: 0x3}, + 89: {cat: 0x2f, setID: 0xa}, + 90: {cat: 0x37, setID: 0x14}, + 91: {cat: 0x65, setID: 0x3}, + 92: {cat: 0x7, setID: 0x1}, + 93: {cat: 0x62, setID: 0x3}, + 94: {cat: 0x7, setID: 0x15}, + 95: {cat: 0x64, setID: 0x3}, + 96: {cat: 0x75, setID: 0x3}, + 97: {cat: 0x7, setID: 0x1}, + 98: {cat: 0x62, setID: 0x3}, + 99: {cat: 0xf, setID: 0xe}, + 100: {cat: 0x1f, setID: 0xf}, + 101: {cat: 0x64, setID: 0x3}, + 102: {cat: 0xf, setID: 0x16}, + 103: {cat: 0x17, setID: 0x1}, + 104: {cat: 0x65, setID: 0x3}, + 105: {cat: 0xf, setID: 0x17}, + 106: {cat: 0x65, setID: 0x3}, + 107: {cat: 0xf, setID: 0xf}, + 108: {cat: 0x65, setID: 0x3}, + 109: {cat: 0x2f, setID: 0x6}, + 110: {cat: 0x3a, setID: 0x7}, + 111: {cat: 0x2f, setID: 0xe}, + 112: {cat: 0x3c, setID: 0xf}, + 113: {cat: 0x2d, setID: 0xa}, + 114: {cat: 0x2d, setID: 0x17}, + 115: {cat: 0x2d, setID: 0x18}, + 116: {cat: 0x2f, setID: 0x6}, + 117: {cat: 0x3a, setID: 0xb}, + 118: {cat: 0x2f, setID: 0x19}, + 119: {cat: 0x3c, setID: 0xb}, + 120: {cat: 0x55, setID: 0x3}, + 121: {cat: 0x22, setID: 0x1}, + 122: {cat: 0x24, setID: 0x3}, + 123: {cat: 0x2c, setID: 0xc}, + 124: {cat: 0x2d, setID: 0xb}, + 125: {cat: 0xf, setID: 0x6}, + 126: {cat: 0x1f, setID: 0x7}, + 127: {cat: 0x62, setID: 0x3}, + 128: {cat: 0xf, setID: 0xe}, + 129: {cat: 0x1f, setID: 0xf}, + 130: {cat: 0x64, setID: 0x3}, + 131: {cat: 0xf, setID: 0xa}, + 132: {cat: 0x65, setID: 0x3}, + 133: {cat: 0xf, setID: 0x17}, + 134: {cat: 0x65, setID: 0x3}, + 135: {cat: 0xf, setID: 0x18}, + 136: {cat: 0x65, setID: 0x3}, + 137: {cat: 0x2f, setID: 0x6}, + 138: {cat: 0x3a, setID: 0x1a}, + 139: {cat: 0x2f, setID: 0x1b}, + 140: {cat: 0x3b, setID: 0x1c}, + 141: {cat: 0x2f, setID: 0x1d}, + 142: {cat: 0x3c, setID: 0x1e}, + 143: {cat: 0x37, setID: 0x3}, + 144: {cat: 0xa5, setID: 0x0}, + 145: {cat: 0x22, setID: 0x1}, + 146: {cat: 0x23, setID: 0x2}, + 147: {cat: 0x24, setID: 0x1f}, + 148: {cat: 0x25, setID: 0x20}, + 149: {cat: 0xf, setID: 0x6}, + 150: {cat: 0x62, setID: 0x3}, + 151: {cat: 0xf, setID: 0x1b}, + 152: {cat: 0x63, setID: 0x3}, + 153: {cat: 0xf, setID: 0x21}, + 154: {cat: 0x64, setID: 0x3}, + 155: {cat: 0x75, setID: 0x3}, + 156: {cat: 0x21, setID: 0x3}, + 157: {cat: 0x22, setID: 0x1}, + 158: {cat: 0x23, setID: 0x2}, + 159: {cat: 0x2c, setID: 0x22}, + 160: {cat: 0x2d, setID: 0x5}, + 161: {cat: 0x21, setID: 0x3}, + 162: {cat: 0x22, setID: 0x1}, + 163: {cat: 0x23, setID: 0x2}, + 164: {cat: 0x24, setID: 0x23}, + 165: {cat: 0x25, setID: 0x24}, +} // Size: 356 bytes + +var cardinalIndex = []uint8{ // 36 elements + 0x00, 0x00, 0x02, 0x03, 0x04, 0x06, 0x09, 0x0a, + 0x0c, 0x0d, 0x10, 0x14, 0x17, 0x1d, 0x28, 0x2b, + 0x2d, 0x2f, 0x32, 0x38, 0x42, 0x45, 0x4c, 0x55, + 0x5c, 0x61, 0x6d, 0x74, 0x79, 0x7d, 0x89, 0x91, + 0x95, 0x9c, 0xa1, 0xa6, +} // Size: 60 bytes + +var cardinalLangToIndex = []uint8{ // 775 elements + // Entry 0 - 3F + 0x00, 0x08, 0x08, 0x08, 0x00, 0x00, 0x06, 0x06, + 0x01, 0x01, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x01, 0x01, 0x08, 0x08, 0x04, 0x04, 0x08, 0x08, + 0x08, 0x08, 0x08, 0x00, 0x00, 0x1a, 0x1a, 0x08, + 0x08, 0x08, 0x08, 0x08, 0x08, 0x06, 0x00, 0x00, + // Entry 40 - 7F + 0x01, 0x01, 0x01, 0x00, 0x00, 0x00, 0x1e, 0x1e, + 0x08, 0x08, 0x13, 0x13, 0x13, 0x13, 0x13, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x08, + 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, + 0x18, 0x18, 0x00, 0x00, 0x22, 0x22, 0x09, 0x09, + 0x09, 0x00, 0x00, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x00, 0x00, 0x16, 0x16, 0x00, + 0x00, 0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 80 - BF + 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + // Entry C0 - FF + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x08, + 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, + 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, + // Entry 100 - 13F + 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, + 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x04, 0x04, + 0x08, 0x08, 0x00, 0x00, 0x01, 0x01, 0x01, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x04, 0x04, 0x0c, 0x0c, + 0x08, 0x08, 0x08, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 140 - 17F + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x08, 0x08, 0x04, 0x04, 0x1f, 0x1f, + 0x14, 0x14, 0x04, 0x04, 0x08, 0x08, 0x08, 0x08, + 0x01, 0x01, 0x06, 0x00, 0x00, 0x20, 0x20, 0x08, + 0x08, 0x08, 0x08, 0x08, 0x08, 0x17, 0x17, 0x01, + 0x01, 0x13, 0x13, 0x13, 0x16, 0x16, 0x08, 0x08, + 0x02, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 180 - 1BF + 0x00, 0x04, 0x0a, 0x0a, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x10, 0x17, 0x00, 0x00, 0x00, 0x08, 0x08, + 0x04, 0x08, 0x08, 0x00, 0x00, 0x08, 0x08, 0x02, + 0x02, 0x08, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x08, 0x08, 0x08, + 0x08, 0x08, 0x08, 0x00, 0x00, 0x00, 0x00, 0x01, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x08, 0x08, + 0x08, 0x08, 0x00, 0x00, 0x0f, 0x0f, 0x08, 0x10, + // Entry 1C0 - 1FF + 0x10, 0x08, 0x08, 0x0e, 0x0e, 0x08, 0x08, 0x08, + 0x08, 0x00, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x1b, 0x1b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0d, 0x0d, 0x08, + 0x08, 0x08, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, + 0x00, 0x00, 0x08, 0x08, 0x0b, 0x0b, 0x08, 0x08, + 0x08, 0x08, 0x12, 0x01, 0x01, 0x00, 0x00, 0x00, + 0x00, 0x1c, 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 200 - 23F + 0x00, 0x08, 0x10, 0x10, 0x08, 0x08, 0x08, 0x08, + 0x08, 0x00, 0x00, 0x00, 0x08, 0x08, 0x08, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x00, + 0x00, 0x08, 0x08, 0x08, 0x08, 0x08, 0x00, 0x08, + 0x06, 0x00, 0x00, 0x08, 0x08, 0x08, 0x08, 0x08, + 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x08, 0x19, 0x19, 0x0d, 0x0d, + 0x08, 0x08, 0x03, 0x04, 0x03, 0x04, 0x04, 0x04, + // Entry 240 - 27F + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x00, + 0x00, 0x00, 0x00, 0x08, 0x08, 0x00, 0x00, 0x12, + 0x12, 0x12, 0x08, 0x08, 0x1d, 0x1d, 0x1d, 0x1d, + 0x1d, 0x1d, 0x1d, 0x00, 0x00, 0x08, 0x08, 0x00, + 0x00, 0x08, 0x08, 0x00, 0x00, 0x08, 0x08, 0x08, + 0x10, 0x10, 0x10, 0x10, 0x08, 0x08, 0x00, 0x00, + 0x00, 0x00, 0x13, 0x11, 0x11, 0x11, 0x11, 0x11, + 0x05, 0x05, 0x18, 0x18, 0x15, 0x15, 0x10, 0x10, + // Entry 280 - 2BF + 0x10, 0x10, 0x10, 0x10, 0x08, 0x08, 0x08, 0x08, + 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x13, + 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, + 0x13, 0x13, 0x08, 0x08, 0x08, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x08, 0x08, + 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, + 0x08, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x06, + 0x08, 0x08, 0x08, 0x0c, 0x08, 0x00, 0x00, 0x08, + // Entry 2C0 - 2FF + 0x08, 0x08, 0x08, 0x00, 0x00, 0x00, 0x00, 0x07, + 0x07, 0x08, 0x08, 0x1d, 0x1d, 0x04, 0x04, 0x04, + 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, 0x00, 0x08, + 0x08, 0x08, 0x08, 0x06, 0x08, 0x08, 0x00, 0x00, + 0x08, 0x08, 0x08, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 300 - 33F + 0x00, 0x00, 0x00, 0x01, 0x01, 0x04, 0x04, +} // Size: 799 bytes + +var cardinalInclusionMasks = []uint64{ // 100 elements + // Entry 0 - 1F + 0x0000000200500419, 0x0000000000512153, 0x000000000a327105, 0x0000000ca23c7101, + 0x00000004a23c7201, 0x0000000482943001, 0x0000001482943201, 0x0000000502943001, + 0x0000000502943001, 0x0000000522943201, 0x0000000540543401, 0x00000000454128e1, + 0x000000005b02e821, 0x000000006304e821, 0x000000006304ea21, 0x0000000042842821, + 0x0000000042842a21, 0x0000000042842821, 0x0000000042842821, 0x0000000062842a21, + 0x0000000200400421, 0x0000000000400061, 0x000000000a004021, 0x0000000022004021, + 0x0000000022004221, 0x0000000002800021, 0x0000000002800221, 0x0000000002800021, + 0x0000000002800021, 0x0000000022800221, 0x0000000000400421, 0x0000000000400061, + // Entry 20 - 3F + 0x000000000a004021, 0x0000000022004021, 0x0000000022004221, 0x0000000002800021, + 0x0000000002800221, 0x0000000002800021, 0x0000000002800021, 0x0000000022800221, + 0x0000000200400421, 0x0000000000400061, 0x000000000a004021, 0x0000000022004021, + 0x0000000022004221, 0x0000000002800021, 0x0000000002800221, 0x0000000002800021, + 0x0000000002800021, 0x0000000022800221, 0x0000000000400421, 0x0000000000400061, + 0x000000000a004021, 0x0000000022004021, 0x0000000022004221, 0x0000000002800021, + 0x0000000002800221, 0x0000000002800021, 0x0000000002800021, 0x0000000022800221, + 0x0000000200400421, 0x0000000000400061, 0x000000000a004021, 0x0000000022004021, + // Entry 40 - 5F + 0x0000000022004221, 0x0000000002800021, 0x0000000002800221, 0x0000000002800021, + 0x0000000002800021, 0x0000000022800221, 0x0000000040400421, 0x0000000044400061, + 0x000000005a004021, 0x0000000062004021, 0x0000000062004221, 0x0000000042800021, + 0x0000000042800221, 0x0000000042800021, 0x0000000042800021, 0x0000000062800221, + 0x0000000200400421, 0x0000000000400061, 0x000000000a004021, 0x0000000022004021, + 0x0000000022004221, 0x0000000002800021, 0x0000000002800221, 0x0000000002800021, + 0x0000000002800021, 0x0000000022800221, 0x0000000040400421, 0x0000000044400061, + 0x000000005a004021, 0x0000000062004021, 0x0000000062004221, 0x0000000042800021, + // Entry 60 - 7F + 0x0000000042800221, 0x0000000042800021, 0x0000000042800021, 0x0000000062800221, +} // Size: 824 bytes + +// Slots used for cardinal: A6 of 0xFF rules; 24 of 0xFF indexes; 37 of 64 sets + +// Total table size 3860 bytes (3KiB); checksum: AAFBF21 diff --git a/vendor/golang.org/x/text/internal/catmsg/catmsg.go b/vendor/golang.org/x/text/internal/catmsg/catmsg.go new file mode 100644 index 0000000..1b257a7 --- /dev/null +++ b/vendor/golang.org/x/text/internal/catmsg/catmsg.go @@ -0,0 +1,417 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package catmsg contains support types for package x/text/message/catalog. +// +// This package contains the low-level implementations of Message used by the +// catalog package and provides primitives for other packages to implement their +// own. For instance, the plural package provides functionality for selecting +// translation strings based on the plural category of substitution arguments. +// +// # Encoding and Decoding +// +// Catalogs store Messages encoded as a single string. Compiling a message into +// a string both results in compacter representation and speeds up evaluation. +// +// A Message must implement a Compile method to convert its arbitrary +// representation to a string. The Compile method takes an Encoder which +// facilitates serializing the message. Encoders also provide more context of +// the messages's creation (such as for which language the message is intended), +// which may not be known at the time of the creation of the message. +// +// Each message type must also have an accompanying decoder registered to decode +// the message. This decoder takes a Decoder argument which provides the +// counterparts for the decoding. +// +// # Renderers +// +// A Decoder must be initialized with a Renderer implementation. These +// implementations must be provided by packages that use Catalogs, typically +// formatting packages such as x/text/message. A typical user will not need to +// worry about this type; it is only relevant to packages that do string +// formatting and want to use the catalog package to handle localized strings. +// +// A package that uses catalogs for selecting strings receives selection results +// as sequence of substrings passed to the Renderer. The following snippet shows +// how to express the above example using the message package. +// +// message.Set(language.English, "You are %d minute(s) late.", +// catalog.Var("minutes", plural.Select(1, "one", "minute")), +// catalog.String("You are %[1]d ${minutes} late.")) +// +// p := message.NewPrinter(language.English) +// p.Printf("You are %d minute(s) late.", 5) // always 5 minutes late. +// +// To evaluate the Printf, package message wraps the arguments in a Renderer +// that is passed to the catalog for message decoding. The call sequence that +// results from evaluating the above message, assuming the person is rather +// tardy, is: +// +// Render("You are %[1]d ") +// Arg(1) +// Render("minutes") +// Render(" late.") +// +// The calls to Arg is caused by the plural.Select execution, which evaluates +// the argument to determine whether the singular or plural message form should +// be selected. The calls to Render reports the partial results to the message +// package for further evaluation. +package catmsg + +import ( + "errors" + "fmt" + "strconv" + "strings" + "sync" + + "golang.org/x/text/language" +) + +// A Handle refers to a registered message type. +type Handle int + +// A Handler decodes and evaluates data compiled by a Message and sends the +// result to the Decoder. The output may depend on the value of the substitution +// arguments, accessible by the Decoder's Arg method. The Handler returns false +// if there is no translation for the given substitution arguments. +type Handler func(d *Decoder) bool + +// Register records the existence of a message type and returns a Handle that +// can be used in the Encoder's EncodeMessageType method to create such +// messages. The prefix of the name should be the package path followed by +// an optional disambiguating string. +// Register will panic if a handle for the same name was already registered. +func Register(name string, handler Handler) Handle { + mutex.Lock() + defer mutex.Unlock() + + if _, ok := names[name]; ok { + panic(fmt.Errorf("catmsg: handler for %q already exists", name)) + } + h := Handle(len(handlers)) + names[name] = h + handlers = append(handlers, handler) + return h +} + +// These handlers require fixed positions in the handlers slice. +const ( + msgVars Handle = iota + msgFirst + msgRaw + msgString + msgAffix + // Leave some arbitrary room for future expansion: 20 should suffice. + numInternal = 20 +) + +const prefix = "golang.org/x/text/internal/catmsg." + +var ( + // TODO: find a more stable way to link handles to message types. + mutex sync.Mutex + names = map[string]Handle{ + prefix + "Vars": msgVars, + prefix + "First": msgFirst, + prefix + "Raw": msgRaw, + prefix + "String": msgString, + prefix + "Affix": msgAffix, + } + handlers = make([]Handler, numInternal) +) + +func init() { + // This handler is a message type wrapper that initializes a decoder + // with a variable block. This message type, if present, is always at the + // start of an encoded message. + handlers[msgVars] = func(d *Decoder) bool { + blockSize := int(d.DecodeUint()) + d.vars = d.data[:blockSize] + d.data = d.data[blockSize:] + return d.executeMessage() + } + + // First takes the first message in a sequence that results in a match for + // the given substitution arguments. + handlers[msgFirst] = func(d *Decoder) bool { + for !d.Done() { + if d.ExecuteMessage() { + return true + } + } + return false + } + + handlers[msgRaw] = func(d *Decoder) bool { + d.Render(d.data) + return true + } + + // A String message alternates between a string constant and a variable + // substitution. + handlers[msgString] = func(d *Decoder) bool { + for !d.Done() { + if str := d.DecodeString(); str != "" { + d.Render(str) + } + if d.Done() { + break + } + d.ExecuteSubstitution() + } + return true + } + + handlers[msgAffix] = func(d *Decoder) bool { + // TODO: use an alternative method for common cases. + prefix := d.DecodeString() + suffix := d.DecodeString() + if prefix != "" { + d.Render(prefix) + } + ret := d.ExecuteMessage() + if suffix != "" { + d.Render(suffix) + } + return ret + } +} + +var ( + // ErrIncomplete indicates a compiled message does not define translations + // for all possible argument values. If this message is returned, evaluating + // a message may result in the ErrNoMatch error. + ErrIncomplete = errors.New("catmsg: incomplete message; may not give result for all inputs") + + // ErrNoMatch indicates no translation message matched the given input + // parameters when evaluating a message. + ErrNoMatch = errors.New("catmsg: no translation for inputs") +) + +// A Message holds a collection of translations for the same phrase that may +// vary based on the values of substitution arguments. +type Message interface { + // Compile encodes the format string(s) of the message as a string for later + // evaluation. + // + // The first call Compile makes on the encoder must be EncodeMessageType. + // The handle passed to this call may either be a handle returned by + // Register to encode a single custom message, or HandleFirst followed by + // a sequence of calls to EncodeMessage. + // + // Compile must return ErrIncomplete if it is possible for evaluation to + // not match any translation for a given set of formatting parameters. + // For example, selecting a translation based on plural form may not yield + // a match if the form "Other" is not one of the selectors. + // + // Compile may return any other application-specific error. For backwards + // compatibility with package like fmt, which often do not do sanity + // checking of format strings ahead of time, Compile should still make an + // effort to have some sensible fallback in case of an error. + Compile(e *Encoder) error +} + +// Compile converts a Message to a data string that can be stored in a Catalog. +// The resulting string can subsequently be decoded by passing to the Execute +// method of a Decoder. +func Compile(tag language.Tag, macros Dictionary, m Message) (data string, err error) { + // TODO: pass macros so they can be used for validation. + v := &Encoder{inBody: true} // encoder for variables + v.root = v + e := &Encoder{root: v, parent: v, tag: tag} // encoder for messages + err = m.Compile(e) + // This package serves te message package, which in turn is meant to be a + // drop-in replacement for fmt. With the fmt package, format strings are + // evaluated lazily and errors are handled by substituting strings in the + // result, rather then returning an error. Dealing with multiple languages + // makes it more important to check errors ahead of time. We chose to be + // consistent and compatible and allow graceful degradation in case of + // errors. + buf := e.buf[stripPrefix(e.buf):] + if len(v.buf) > 0 { + // Prepend variable block. + b := make([]byte, 1+maxVarintBytes+len(v.buf)+len(buf)) + b[0] = byte(msgVars) + b = b[:1+encodeUint(b[1:], uint64(len(v.buf)))] + b = append(b, v.buf...) + b = append(b, buf...) + buf = b + } + if err == nil { + err = v.err + } + return string(buf), err +} + +// FirstOf is a message type that prints the first message in the sequence that +// resolves to a match for the given substitution arguments. +type FirstOf []Message + +// Compile implements Message. +func (s FirstOf) Compile(e *Encoder) error { + e.EncodeMessageType(msgFirst) + err := ErrIncomplete + for i, m := range s { + if err == nil { + return fmt.Errorf("catalog: message argument %d is complete and blocks subsequent messages", i-1) + } + err = e.EncodeMessage(m) + } + return err +} + +// Var defines a message that can be substituted for a placeholder of the same +// name. If an expression does not result in a string after evaluation, Name is +// used as the substitution. For example: +// +// Var{ +// Name: "minutes", +// Message: plural.Select(1, "one", "minute"), +// } +// +// will resolve to minute for singular and minutes for plural forms. +type Var struct { + Name string + Message Message +} + +var errIsVar = errors.New("catmsg: variable used as message") + +// Compile implements Message. +// +// Note that this method merely registers a variable; it does not create an +// encoded message. +func (v *Var) Compile(e *Encoder) error { + if err := e.addVar(v.Name, v.Message); err != nil { + return err + } + // Using a Var by itself is an error. If it is in a sequence followed by + // other messages referring to it, this error will be ignored. + return errIsVar +} + +// Raw is a message consisting of a single format string that is passed as is +// to the Renderer. +// +// Note that a Renderer may still do its own variable substitution. +type Raw string + +// Compile implements Message. +func (r Raw) Compile(e *Encoder) (err error) { + e.EncodeMessageType(msgRaw) + // Special case: raw strings don't have a size encoding and so don't use + // EncodeString. + e.buf = append(e.buf, r...) + return nil +} + +// String is a message consisting of a single format string which contains +// placeholders that may be substituted with variables. +// +// Variable substitutions are marked with placeholders and a variable name of +// the form ${name}. Any other substitutions such as Go templates or +// printf-style substitutions are left to be done by the Renderer. +// +// When evaluation a string interpolation, a Renderer will receive separate +// calls for each placeholder and interstitial string. For example, for the +// message: "%[1]v ${invites} %[2]v to ${their} party." The sequence of calls +// is: +// +// d.Render("%[1]v ") +// d.Arg(1) +// d.Render(resultOfInvites) +// d.Render(" %[2]v to ") +// d.Arg(2) +// d.Render(resultOfTheir) +// d.Render(" party.") +// +// where the messages for "invites" and "their" both use a plural.Select +// referring to the first argument. +// +// Strings may also invoke macros. Macros are essentially variables that can be +// reused. Macros may, for instance, be used to make selections between +// different conjugations of a verb. See the catalog package description for an +// overview of macros. +type String string + +// Compile implements Message. It parses the placeholder formats and returns +// any error. +func (s String) Compile(e *Encoder) (err error) { + msg := string(s) + const subStart = "${" + hasHeader := false + p := 0 + b := []byte{} + for { + i := strings.Index(msg[p:], subStart) + if i == -1 { + break + } + b = append(b, msg[p:p+i]...) + p += i + len(subStart) + if i = strings.IndexByte(msg[p:], '}'); i == -1 { + b = append(b, "$!(MISSINGBRACE)"...) + err = fmt.Errorf("catmsg: missing '}'") + p = len(msg) + break + } + name := strings.TrimSpace(msg[p : p+i]) + if q := strings.IndexByte(name, '('); q == -1 { + if !hasHeader { + hasHeader = true + e.EncodeMessageType(msgString) + } + e.EncodeString(string(b)) + e.EncodeSubstitution(name) + b = b[:0] + } else if j := strings.IndexByte(name[q:], ')'); j == -1 { + // TODO: what should the error be? + b = append(b, "$!(MISSINGPAREN)"...) + err = fmt.Errorf("catmsg: missing ')'") + } else if x, sErr := strconv.ParseUint(strings.TrimSpace(name[q+1:q+j]), 10, 32); sErr != nil { + // TODO: handle more than one argument + b = append(b, "$!(BADNUM)"...) + err = fmt.Errorf("catmsg: invalid number %q", strings.TrimSpace(name[q+1:q+j])) + } else { + if !hasHeader { + hasHeader = true + e.EncodeMessageType(msgString) + } + e.EncodeString(string(b)) + e.EncodeSubstitution(name[:q], int(x)) + b = b[:0] + } + p += i + 1 + } + b = append(b, msg[p:]...) + if !hasHeader { + // Simplify string to a raw string. + Raw(string(b)).Compile(e) + } else if len(b) > 0 { + e.EncodeString(string(b)) + } + return err +} + +// Affix is a message that adds a prefix and suffix to another message. +// This is mostly used add back whitespace to a translation that was stripped +// before sending it out. +type Affix struct { + Message Message + Prefix string + Suffix string +} + +// Compile implements Message. +func (a Affix) Compile(e *Encoder) (err error) { + // TODO: consider adding a special message type that just adds a single + // return. This is probably common enough to handle the majority of cases. + // Get some stats first, though. + e.EncodeMessageType(msgAffix) + e.EncodeString(a.Prefix) + e.EncodeString(a.Suffix) + e.EncodeMessage(a.Message) + return nil +} diff --git a/vendor/golang.org/x/text/internal/catmsg/codec.go b/vendor/golang.org/x/text/internal/catmsg/codec.go new file mode 100644 index 0000000..547802b --- /dev/null +++ b/vendor/golang.org/x/text/internal/catmsg/codec.go @@ -0,0 +1,407 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package catmsg + +import ( + "errors" + "fmt" + + "golang.org/x/text/language" +) + +// A Renderer renders a Message. +type Renderer interface { + // Render renders the given string. The given string may be interpreted as a + // format string, such as the one used by the fmt package or a template. + Render(s string) + + // Arg returns the i-th argument passed to format a message. This method + // should return nil if there is no such argument. Messages need access to + // arguments to allow selecting a message based on linguistic features of + // those arguments. + Arg(i int) interface{} +} + +// A Dictionary specifies a source of messages, including variables or macros. +type Dictionary interface { + // Lookup returns the message for the given key. It returns false for ok if + // such a message could not be found. + Lookup(key string) (data string, ok bool) + + // TODO: consider returning an interface, instead of a string. This will + // allow implementations to do their own message type decoding. +} + +// An Encoder serializes a Message to a string. +type Encoder struct { + // The root encoder is used for storing encoded variables. + root *Encoder + // The parent encoder provides the surrounding scopes for resolving variable + // names. + parent *Encoder + + tag language.Tag + + // buf holds the encoded message so far. After a message completes encoding, + // the contents of buf, prefixed by the encoded length, are flushed to the + // parent buffer. + buf []byte + + // vars is the lookup table of variables in the current scope. + vars []keyVal + + err error + inBody bool // if false next call must be EncodeMessageType +} + +type keyVal struct { + key string + offset int +} + +// Language reports the language for which the encoded message will be stored +// in the Catalog. +func (e *Encoder) Language() language.Tag { return e.tag } + +func (e *Encoder) setError(err error) { + if e.root.err == nil { + e.root.err = err + } +} + +// EncodeUint encodes x. +func (e *Encoder) EncodeUint(x uint64) { + e.checkInBody() + var buf [maxVarintBytes]byte + n := encodeUint(buf[:], x) + e.buf = append(e.buf, buf[:n]...) +} + +// EncodeString encodes s. +func (e *Encoder) EncodeString(s string) { + e.checkInBody() + e.EncodeUint(uint64(len(s))) + e.buf = append(e.buf, s...) +} + +// EncodeMessageType marks the current message to be of type h. +// +// It must be the first call of a Message's Compile method. +func (e *Encoder) EncodeMessageType(h Handle) { + if e.inBody { + panic("catmsg: EncodeMessageType not the first method called") + } + e.inBody = true + e.EncodeUint(uint64(h)) +} + +// EncodeMessage serializes the given message inline at the current position. +func (e *Encoder) EncodeMessage(m Message) error { + e = &Encoder{root: e.root, parent: e, tag: e.tag} + err := m.Compile(e) + if _, ok := m.(*Var); !ok { + e.flushTo(e.parent) + } + return err +} + +func (e *Encoder) checkInBody() { + if !e.inBody { + panic("catmsg: expected prior call to EncodeMessageType") + } +} + +// stripPrefix indicates the number of prefix bytes that must be stripped to +// turn a single-element sequence into a message that is just this single member +// without its size prefix. If the message can be stripped, b[1:n] contains the +// size prefix. +func stripPrefix(b []byte) (n int) { + if len(b) > 0 && Handle(b[0]) == msgFirst { + x, n, _ := decodeUint(b[1:]) + if 1+n+int(x) == len(b) { + return 1 + n + } + } + return 0 +} + +func (e *Encoder) flushTo(dst *Encoder) { + data := e.buf + p := stripPrefix(data) + if p > 0 { + data = data[1:] + } else { + // Prefix the size. + dst.EncodeUint(uint64(len(data))) + } + dst.buf = append(dst.buf, data...) +} + +func (e *Encoder) addVar(key string, m Message) error { + for _, v := range e.parent.vars { + if v.key == key { + err := fmt.Errorf("catmsg: duplicate variable %q", key) + e.setError(err) + return err + } + } + scope := e.parent + // If a variable message is Incomplete, and does not evaluate to a message + // during execution, we fall back to the variable name. We encode this by + // appending the variable name if the message reports it's incomplete. + + err := m.Compile(e) + if err != ErrIncomplete { + e.setError(err) + } + switch { + case len(e.buf) == 1 && Handle(e.buf[0]) == msgFirst: // empty sequence + e.buf = e.buf[:0] + e.inBody = false + fallthrough + case len(e.buf) == 0: + // Empty message. + if err := String(key).Compile(e); err != nil { + e.setError(err) + } + case err == ErrIncomplete: + if Handle(e.buf[0]) != msgFirst { + seq := &Encoder{root: e.root, parent: e} + seq.EncodeMessageType(msgFirst) + e.flushTo(seq) + e = seq + } + // e contains a sequence; append the fallback string. + e.EncodeMessage(String(key)) + } + + // Flush result to variable heap. + offset := len(e.root.buf) + e.flushTo(e.root) + e.buf = e.buf[:0] + + // Record variable offset in current scope. + scope.vars = append(scope.vars, keyVal{key: key, offset: offset}) + return err +} + +const ( + substituteVar = iota + substituteMacro + substituteError +) + +// EncodeSubstitution inserts a resolved reference to a variable or macro. +// +// This call must be matched with a call to ExecuteSubstitution at decoding +// time. +func (e *Encoder) EncodeSubstitution(name string, arguments ...int) { + if arity := len(arguments); arity > 0 { + // TODO: also resolve macros. + e.EncodeUint(substituteMacro) + e.EncodeString(name) + for _, a := range arguments { + e.EncodeUint(uint64(a)) + } + return + } + for scope := e; scope != nil; scope = scope.parent { + for _, v := range scope.vars { + if v.key != name { + continue + } + e.EncodeUint(substituteVar) // TODO: support arity > 0 + e.EncodeUint(uint64(v.offset)) + return + } + } + // TODO: refer to dictionary-wide scoped variables. + e.EncodeUint(substituteError) + e.EncodeString(name) + e.setError(fmt.Errorf("catmsg: unknown var %q", name)) +} + +// A Decoder deserializes and evaluates messages that are encoded by an encoder. +type Decoder struct { + tag language.Tag + dst Renderer + macros Dictionary + + err error + vars string + data string + + macroArg int // TODO: allow more than one argument +} + +// NewDecoder returns a new Decoder. +// +// Decoders are designed to be reused for multiple invocations of Execute. +// Only one goroutine may call Execute concurrently. +func NewDecoder(tag language.Tag, r Renderer, macros Dictionary) *Decoder { + return &Decoder{ + tag: tag, + dst: r, + macros: macros, + } +} + +func (d *Decoder) setError(err error) { + if d.err == nil { + d.err = err + } +} + +// Language returns the language in which the message is being rendered. +// +// The destination language may be a child language of the language used for +// encoding. For instance, a decoding language of "pt-PT" is consistent with an +// encoding language of "pt". +func (d *Decoder) Language() language.Tag { return d.tag } + +// Done reports whether there are more bytes to process in this message. +func (d *Decoder) Done() bool { return len(d.data) == 0 } + +// Render implements Renderer. +func (d *Decoder) Render(s string) { d.dst.Render(s) } + +// Arg implements Renderer. +// +// During evaluation of macros, the argument positions may be mapped to +// arguments that differ from the original call. +func (d *Decoder) Arg(i int) interface{} { + if d.macroArg != 0 { + if i != 1 { + panic("catmsg: only macros with single argument supported") + } + i = d.macroArg + } + return d.dst.Arg(i) +} + +// DecodeUint decodes a number that was encoded with EncodeUint and advances the +// position. +func (d *Decoder) DecodeUint() uint64 { + x, n, err := decodeUintString(d.data) + d.data = d.data[n:] + if err != nil { + d.setError(err) + } + return x +} + +// DecodeString decodes a string that was encoded with EncodeString and advances +// the position. +func (d *Decoder) DecodeString() string { + size := d.DecodeUint() + s := d.data[:size] + d.data = d.data[size:] + return s +} + +// SkipMessage skips the message at the current location and advances the +// position. +func (d *Decoder) SkipMessage() { + n := int(d.DecodeUint()) + d.data = d.data[n:] +} + +// Execute decodes and evaluates msg. +// +// Only one goroutine may call execute. +func (d *Decoder) Execute(msg string) error { + d.err = nil + if !d.execute(msg) { + return ErrNoMatch + } + return d.err +} + +func (d *Decoder) execute(msg string) bool { + saved := d.data + d.data = msg + ok := d.executeMessage() + d.data = saved + return ok +} + +// executeMessageFromData is like execute, but also decodes a leading message +// size and clips the given string accordingly. +// +// It reports the number of bytes consumed and whether a message was selected. +func (d *Decoder) executeMessageFromData(s string) (n int, ok bool) { + saved := d.data + d.data = s + size := int(d.DecodeUint()) + n = len(s) - len(d.data) + // Sanitize the setting. This allows skipping a size argument for + // RawString and method Done. + d.data = d.data[:size] + ok = d.executeMessage() + n += size - len(d.data) + d.data = saved + return n, ok +} + +var errUnknownHandler = errors.New("catmsg: string contains unsupported handler") + +// executeMessage reads the handle id, initializes the decoder and executes the +// message. It is assumed that all of d.data[d.p:] is the single message. +func (d *Decoder) executeMessage() bool { + if d.Done() { + // We interpret no data as a valid empty message. + return true + } + handle := d.DecodeUint() + + var fn Handler + mutex.Lock() + if int(handle) < len(handlers) { + fn = handlers[handle] + } + mutex.Unlock() + if fn == nil { + d.setError(errUnknownHandler) + d.execute(fmt.Sprintf("\x02$!(UNKNOWNMSGHANDLER=%#x)", handle)) + return true + } + return fn(d) +} + +// ExecuteMessage decodes and executes the message at the current position. +func (d *Decoder) ExecuteMessage() bool { + n, ok := d.executeMessageFromData(d.data) + d.data = d.data[n:] + return ok +} + +// ExecuteSubstitution executes the message corresponding to the substitution +// as encoded by EncodeSubstitution. +func (d *Decoder) ExecuteSubstitution() { + switch x := d.DecodeUint(); x { + case substituteVar: + offset := d.DecodeUint() + d.executeMessageFromData(d.vars[offset:]) + case substituteMacro: + name := d.DecodeString() + data, ok := d.macros.Lookup(name) + old := d.macroArg + // TODO: support macros of arity other than 1. + d.macroArg = int(d.DecodeUint()) + switch { + case !ok: + // TODO: detect this at creation time. + d.setError(fmt.Errorf("catmsg: undefined macro %q", name)) + fallthrough + case !d.execute(data): + d.dst.Render(name) // fall back to macro name. + } + d.macroArg = old + case substituteError: + d.dst.Render(d.DecodeString()) + default: + panic("catmsg: unreachable") + } +} diff --git a/vendor/golang.org/x/text/internal/catmsg/varint.go b/vendor/golang.org/x/text/internal/catmsg/varint.go new file mode 100644 index 0000000..a2cee2c --- /dev/null +++ b/vendor/golang.org/x/text/internal/catmsg/varint.go @@ -0,0 +1,62 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package catmsg + +// This file implements varint encoding analogous to the one in encoding/binary. +// We need a string version of this function, so we add that here and then add +// the rest for consistency. + +import "errors" + +var ( + errIllegalVarint = errors.New("catmsg: illegal varint") + errVarintTooLarge = errors.New("catmsg: varint too large for uint64") +) + +const maxVarintBytes = 10 // maximum length of a varint + +// encodeUint encodes x as a variable-sized integer into buf and returns the +// number of bytes written. buf must be at least maxVarintBytes long +func encodeUint(buf []byte, x uint64) (n int) { + for ; x > 127; n++ { + buf[n] = 0x80 | uint8(x&0x7F) + x >>= 7 + } + buf[n] = uint8(x) + n++ + return n +} + +func decodeUintString(s string) (x uint64, size int, err error) { + i := 0 + for shift := uint(0); shift < 64; shift += 7 { + if i >= len(s) { + return 0, i, errIllegalVarint + } + b := uint64(s[i]) + i++ + x |= (b & 0x7F) << shift + if b&0x80 == 0 { + return x, i, nil + } + } + return 0, i, errVarintTooLarge +} + +func decodeUint(b []byte) (x uint64, size int, err error) { + i := 0 + for shift := uint(0); shift < 64; shift += 7 { + if i >= len(b) { + return 0, i, errIllegalVarint + } + c := uint64(b[i]) + i++ + x |= (c & 0x7F) << shift + if c&0x80 == 0 { + return x, i, nil + } + } + return 0, i, errVarintTooLarge +} diff --git a/vendor/golang.org/x/text/internal/format/format.go b/vendor/golang.org/x/text/internal/format/format.go new file mode 100644 index 0000000..ee1c57a --- /dev/null +++ b/vendor/golang.org/x/text/internal/format/format.go @@ -0,0 +1,41 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package format contains types for defining language-specific formatting of +// values. +// +// This package is internal now, but will eventually be exposed after the API +// settles. +package format // import "golang.org/x/text/internal/format" + +import ( + "fmt" + + "golang.org/x/text/language" +) + +// State represents the printer state passed to custom formatters. It provides +// access to the fmt.State interface and the sentence and language-related +// context. +type State interface { + fmt.State + + // Language reports the requested language in which to render a message. + Language() language.Tag + + // TODO: consider this and removing rune from the Format method in the + // Formatter interface. + // + // Verb returns the format variant to render, analogous to the types used + // in fmt. Use 'v' for the default or only variant. + // Verb() rune + + // TODO: more info: + // - sentence context such as linguistic features passed by the translator. +} + +// Formatter is analogous to fmt.Formatter. +type Formatter interface { + Format(state State, verb rune) +} diff --git a/vendor/golang.org/x/text/internal/format/parser.go b/vendor/golang.org/x/text/internal/format/parser.go new file mode 100644 index 0000000..855aed7 --- /dev/null +++ b/vendor/golang.org/x/text/internal/format/parser.go @@ -0,0 +1,358 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package format + +import ( + "reflect" + "unicode/utf8" +) + +// A Parser parses a format string. The result from the parse are set in the +// struct fields. +type Parser struct { + Verb rune + + WidthPresent bool + PrecPresent bool + Minus bool + Plus bool + Sharp bool + Space bool + Zero bool + + // For the formats %+v %#v, we set the plusV/sharpV flags + // and clear the plus/sharp flags since %+v and %#v are in effect + // different, flagless formats set at the top level. + PlusV bool + SharpV bool + + HasIndex bool + + Width int + Prec int // precision + + // retain arguments across calls. + Args []interface{} + // retain current argument number across calls + ArgNum int + + // reordered records whether the format string used argument reordering. + Reordered bool + // goodArgNum records whether the most recent reordering directive was valid. + goodArgNum bool + + // position info + format string + startPos int + endPos int + Status Status +} + +// Reset initializes a parser to scan format strings for the given args. +func (p *Parser) Reset(args []interface{}) { + p.Args = args + p.ArgNum = 0 + p.startPos = 0 + p.Reordered = false +} + +// Text returns the part of the format string that was parsed by the last call +// to Scan. It returns the original substitution clause if the current scan +// parsed a substitution. +func (p *Parser) Text() string { return p.format[p.startPos:p.endPos] } + +// SetFormat sets a new format string to parse. It does not reset the argument +// count. +func (p *Parser) SetFormat(format string) { + p.format = format + p.startPos = 0 + p.endPos = 0 +} + +// Status indicates the result type of a call to Scan. +type Status int + +const ( + StatusText Status = iota + StatusSubstitution + StatusBadWidthSubstitution + StatusBadPrecSubstitution + StatusNoVerb + StatusBadArgNum + StatusMissingArg +) + +// ClearFlags reset the parser to default behavior. +func (p *Parser) ClearFlags() { + p.WidthPresent = false + p.PrecPresent = false + p.Minus = false + p.Plus = false + p.Sharp = false + p.Space = false + p.Zero = false + + p.PlusV = false + p.SharpV = false + + p.HasIndex = false +} + +// Scan scans the next part of the format string and sets the status to +// indicate whether it scanned a string literal, substitution or error. +func (p *Parser) Scan() bool { + p.Status = StatusText + format := p.format + end := len(format) + if p.endPos >= end { + return false + } + afterIndex := false // previous item in format was an index like [3]. + + p.startPos = p.endPos + p.goodArgNum = true + i := p.startPos + for i < end && format[i] != '%' { + i++ + } + if i > p.startPos { + p.endPos = i + return true + } + // Process one verb + i++ + + p.Status = StatusSubstitution + + // Do we have flags? + p.ClearFlags() + +simpleFormat: + for ; i < end; i++ { + c := p.format[i] + switch c { + case '#': + p.Sharp = true + case '0': + p.Zero = !p.Minus // Only allow zero padding to the left. + case '+': + p.Plus = true + case '-': + p.Minus = true + p.Zero = false // Do not pad with zeros to the right. + case ' ': + p.Space = true + default: + // Fast path for common case of ascii lower case simple verbs + // without precision or width or argument indices. + if 'a' <= c && c <= 'z' && p.ArgNum < len(p.Args) { + if c == 'v' { + // Go syntax + p.SharpV = p.Sharp + p.Sharp = false + // Struct-field syntax + p.PlusV = p.Plus + p.Plus = false + } + p.Verb = rune(c) + p.ArgNum++ + p.endPos = i + 1 + return true + } + // Format is more complex than simple flags and a verb or is malformed. + break simpleFormat + } + } + + // Do we have an explicit argument index? + i, afterIndex = p.updateArgNumber(format, i) + + // Do we have width? + if i < end && format[i] == '*' { + i++ + p.Width, p.WidthPresent = p.intFromArg() + + if !p.WidthPresent { + p.Status = StatusBadWidthSubstitution + } + + // We have a negative width, so take its value and ensure + // that the minus flag is set + if p.Width < 0 { + p.Width = -p.Width + p.Minus = true + p.Zero = false // Do not pad with zeros to the right. + } + afterIndex = false + } else { + p.Width, p.WidthPresent, i = parsenum(format, i, end) + if afterIndex && p.WidthPresent { // "%[3]2d" + p.goodArgNum = false + } + } + + // Do we have precision? + if i+1 < end && format[i] == '.' { + i++ + if afterIndex { // "%[3].2d" + p.goodArgNum = false + } + i, afterIndex = p.updateArgNumber(format, i) + if i < end && format[i] == '*' { + i++ + p.Prec, p.PrecPresent = p.intFromArg() + // Negative precision arguments don't make sense + if p.Prec < 0 { + p.Prec = 0 + p.PrecPresent = false + } + if !p.PrecPresent { + p.Status = StatusBadPrecSubstitution + } + afterIndex = false + } else { + p.Prec, p.PrecPresent, i = parsenum(format, i, end) + if !p.PrecPresent { + p.Prec = 0 + p.PrecPresent = true + } + } + } + + if !afterIndex { + i, afterIndex = p.updateArgNumber(format, i) + } + p.HasIndex = afterIndex + + if i >= end { + p.endPos = i + p.Status = StatusNoVerb + return true + } + + verb, w := utf8.DecodeRuneInString(format[i:]) + p.endPos = i + w + p.Verb = verb + + switch { + case verb == '%': // Percent does not absorb operands and ignores f.wid and f.prec. + p.startPos = p.endPos - 1 + p.Status = StatusText + case !p.goodArgNum: + p.Status = StatusBadArgNum + case p.ArgNum >= len(p.Args): // No argument left over to print for the current verb. + p.Status = StatusMissingArg + p.ArgNum++ + case verb == 'v': + // Go syntax + p.SharpV = p.Sharp + p.Sharp = false + // Struct-field syntax + p.PlusV = p.Plus + p.Plus = false + fallthrough + default: + p.ArgNum++ + } + return true +} + +// intFromArg gets the ArgNumth element of Args. On return, isInt reports +// whether the argument has integer type. +func (p *Parser) intFromArg() (num int, isInt bool) { + if p.ArgNum < len(p.Args) { + arg := p.Args[p.ArgNum] + num, isInt = arg.(int) // Almost always OK. + if !isInt { + // Work harder. + switch v := reflect.ValueOf(arg); v.Kind() { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + n := v.Int() + if int64(int(n)) == n { + num = int(n) + isInt = true + } + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + n := v.Uint() + if int64(n) >= 0 && uint64(int(n)) == n { + num = int(n) + isInt = true + } + default: + // Already 0, false. + } + } + p.ArgNum++ + if tooLarge(num) { + num = 0 + isInt = false + } + } + return +} + +// parseArgNumber returns the value of the bracketed number, minus 1 +// (explicit argument numbers are one-indexed but we want zero-indexed). +// The opening bracket is known to be present at format[0]. +// The returned values are the index, the number of bytes to consume +// up to the closing paren, if present, and whether the number parsed +// ok. The bytes to consume will be 1 if no closing paren is present. +func parseArgNumber(format string) (index int, wid int, ok bool) { + // There must be at least 3 bytes: [n]. + if len(format) < 3 { + return 0, 1, false + } + + // Find closing bracket. + for i := 1; i < len(format); i++ { + if format[i] == ']' { + width, ok, newi := parsenum(format, 1, i) + if !ok || newi != i { + return 0, i + 1, false + } + return width - 1, i + 1, true // arg numbers are one-indexed and skip paren. + } + } + return 0, 1, false +} + +// updateArgNumber returns the next argument to evaluate, which is either the value of the passed-in +// argNum or the value of the bracketed integer that begins format[i:]. It also returns +// the new value of i, that is, the index of the next byte of the format to process. +func (p *Parser) updateArgNumber(format string, i int) (newi int, found bool) { + if len(format) <= i || format[i] != '[' { + return i, false + } + p.Reordered = true + index, wid, ok := parseArgNumber(format[i:]) + if ok && 0 <= index && index < len(p.Args) { + p.ArgNum = index + return i + wid, true + } + p.goodArgNum = false + return i + wid, ok +} + +// tooLarge reports whether the magnitude of the integer is +// too large to be used as a formatting width or precision. +func tooLarge(x int) bool { + const max int = 1e6 + return x > max || x < -max +} + +// parsenum converts ASCII to integer. num is 0 (and isnum is false) if no number present. +func parsenum(s string, start, end int) (num int, isnum bool, newi int) { + if start >= end { + return 0, false, end + } + for newi = start; newi < end && '0' <= s[newi] && s[newi] <= '9'; newi++ { + if tooLarge(num) { + return 0, false, end // Overflow; crazy long number most likely. + } + num = num*10 + int(s[newi]-'0') + isnum = true + } + return +} diff --git a/vendor/golang.org/x/text/internal/internal.go b/vendor/golang.org/x/text/internal/internal.go new file mode 100644 index 0000000..3cddbbd --- /dev/null +++ b/vendor/golang.org/x/text/internal/internal.go @@ -0,0 +1,49 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package internal contains non-exported functionality that are used by +// packages in the text repository. +package internal // import "golang.org/x/text/internal" + +import ( + "sort" + + "golang.org/x/text/language" +) + +// SortTags sorts tags in place. +func SortTags(tags []language.Tag) { + sort.Sort(sorter(tags)) +} + +type sorter []language.Tag + +func (s sorter) Len() int { + return len(s) +} + +func (s sorter) Swap(i, j int) { + s[i], s[j] = s[j], s[i] +} + +func (s sorter) Less(i, j int) bool { + return s[i].String() < s[j].String() +} + +// UniqueTags sorts and filters duplicate tags in place and returns a slice with +// only unique tags. +func UniqueTags(tags []language.Tag) []language.Tag { + if len(tags) <= 1 { + return tags + } + SortTags(tags) + k := 0 + for i := 1; i < len(tags); i++ { + if tags[k].String() < tags[i].String() { + k++ + tags[k] = tags[i] + } + } + return tags[:k+1] +} diff --git a/vendor/golang.org/x/text/internal/language/common.go b/vendor/golang.org/x/text/internal/language/common.go new file mode 100644 index 0000000..cdfdb74 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/common.go @@ -0,0 +1,16 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +// This file contains code common to the maketables.go and the package code. + +// AliasType is the type of an alias in AliasMap. +type AliasType int8 + +const ( + Deprecated AliasType = iota + Macro + Legacy + + AliasTypeUnknown AliasType = -1 +) diff --git a/vendor/golang.org/x/text/internal/language/compact.go b/vendor/golang.org/x/text/internal/language/compact.go new file mode 100644 index 0000000..46a0015 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact.go @@ -0,0 +1,29 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// CompactCoreInfo is a compact integer with the three core tags encoded. +type CompactCoreInfo uint32 + +// GetCompactCore generates a uint32 value that is guaranteed to be unique for +// different language, region, and script values. +func GetCompactCore(t Tag) (cci CompactCoreInfo, ok bool) { + if t.LangID > langNoIndexOffset { + return 0, false + } + cci |= CompactCoreInfo(t.LangID) << (8 + 12) + cci |= CompactCoreInfo(t.ScriptID) << 12 + cci |= CompactCoreInfo(t.RegionID) + return cci, true +} + +// Tag generates a tag from c. +func (c CompactCoreInfo) Tag() Tag { + return Tag{ + LangID: Language(c >> 20), + RegionID: Region(c & 0x3ff), + ScriptID: Script(c>>12) & 0xff, + } +} diff --git a/vendor/golang.org/x/text/internal/language/compact/compact.go b/vendor/golang.org/x/text/internal/language/compact/compact.go new file mode 100644 index 0000000..1b36935 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/compact.go @@ -0,0 +1,61 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package compact defines a compact representation of language tags. +// +// Common language tags (at least all for which locale information is defined +// in CLDR) are assigned a unique index. Each Tag is associated with such an +// ID for selecting language-related resources (such as translations) as well +// as one for selecting regional defaults (currency, number formatting, etc.) +// +// It may want to export this functionality at some point, but at this point +// this is only available for use within x/text. +package compact // import "golang.org/x/text/internal/language/compact" + +import ( + "sort" + "strings" + + "golang.org/x/text/internal/language" +) + +// ID is an integer identifying a single tag. +type ID uint16 + +func getCoreIndex(t language.Tag) (id ID, ok bool) { + cci, ok := language.GetCompactCore(t) + if !ok { + return 0, false + } + i := sort.Search(len(coreTags), func(i int) bool { + return cci <= coreTags[i] + }) + if i == len(coreTags) || coreTags[i] != cci { + return 0, false + } + return ID(i), true +} + +// Parent returns the ID of the parent or the root ID if id is already the root. +func (id ID) Parent() ID { + return parents[id] +} + +// Tag converts id to an internal language Tag. +func (id ID) Tag() language.Tag { + if int(id) >= len(coreTags) { + return specialTags[int(id)-len(coreTags)] + } + return coreTags[id].Tag() +} + +var specialTags []language.Tag + +func init() { + tags := strings.Split(specialTagsStr, " ") + specialTags = make([]language.Tag, len(tags)) + for i, t := range tags { + specialTags[i] = language.MustParse(t) + } +} diff --git a/vendor/golang.org/x/text/internal/language/compact/language.go b/vendor/golang.org/x/text/internal/language/compact/language.go new file mode 100644 index 0000000..8c1b666 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/language.go @@ -0,0 +1,260 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_index.go -output tables.go +//go:generate go run gen_parents.go + +package compact + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "strings" + + "golang.org/x/text/internal/language" +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. +type Tag struct { + // NOTE: exported tags will become part of the public API. + language ID + locale ID + full fullTag // always a language.Tag for now. +} + +const _und = 0 + +type fullTag interface { + IsRoot() bool + Parent() language.Tag +} + +// Make a compact Tag from a fully specified internal language Tag. +func Make(t language.Tag) (tag Tag) { + if region := t.TypeForKey("rg"); len(region) == 6 && region[2:] == "zzzz" { + if r, err := language.ParseRegion(region[:2]); err == nil { + tFull := t + t, _ = t.SetTypeForKey("rg", "") + // TODO: should we not consider "va" for the language tag? + var exact1, exact2 bool + tag.language, exact1 = FromTag(t) + t.RegionID = r + tag.locale, exact2 = FromTag(t) + if !exact1 || !exact2 { + tag.full = tFull + } + return tag + } + } + lang, ok := FromTag(t) + tag.language = lang + tag.locale = lang + if !ok { + tag.full = t + } + return tag +} + +// Tag returns an internal language Tag version of this tag. +func (t Tag) Tag() language.Tag { + if t.full != nil { + return t.full.(language.Tag) + } + tag := t.language.Tag() + if t.language != t.locale { + loc := t.locale.Tag() + tag, _ = tag.SetTypeForKey("rg", strings.ToLower(loc.RegionID.String())+"zzzz") + } + return tag +} + +// IsCompact reports whether this tag is fully defined in terms of ID. +func (t *Tag) IsCompact() bool { + return t.full == nil +} + +// MayHaveVariants reports whether a tag may have variants. If it returns false +// it is guaranteed the tag does not have variants. +func (t Tag) MayHaveVariants() bool { + return t.full != nil || int(t.language) >= len(coreTags) +} + +// MayHaveExtensions reports whether a tag may have extensions. If it returns +// false it is guaranteed the tag does not have them. +func (t Tag) MayHaveExtensions() bool { + return t.full != nil || + int(t.language) >= len(coreTags) || + t.language != t.locale +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + if t.full != nil { + return t.full.IsRoot() + } + return t.language == _und +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +func (t Tag) Parent() Tag { + if t.full != nil { + return Make(t.full.Parent()) + } + if t.language != t.locale { + // Simulate stripping -u-rg-xxxxxx + return Tag{language: t.language, locale: t.language} + } + // TODO: use parent lookup table once cycle from internal package is + // removed. Probably by internalizing the table and declaring this fast + // enough. + // lang := compactID(internal.Parent(uint16(t.language))) + lang, _ := FromTag(t.language.Tag().Parent()) + return Tag{language: lang, locale: lang} +} + +// nextToken returns token t and the rest of the string. +func nextToken(s string) (t, tail string) { + p := strings.Index(s[1:], "-") + if p == -1 { + return s[1:], "" + } + p++ + return s[1:p], s[p:] +} + +// LanguageID returns an index, where 0 <= index < NumCompactTags, for tags +// for which data exists in the text repository.The index will change over time +// and should not be stored in persistent storage. If t does not match a compact +// index, exact will be false and the compact index will be returned for the +// first match after repeatedly taking the Parent of t. +func LanguageID(t Tag) (id ID, exact bool) { + return t.language, t.full == nil +} + +// RegionalID returns the ID for the regional variant of this tag. This index is +// used to indicate region-specific overrides, such as default currency, default +// calendar and week data, default time cycle, and default measurement system +// and unit preferences. +// +// For instance, the tag en-GB-u-rg-uszzzz specifies British English with US +// settings for currency, number formatting, etc. The CompactIndex for this tag +// will be that for en-GB, while the RegionalID will be the one corresponding to +// en-US. +func RegionalID(t Tag) (id ID, exact bool) { + return t.locale, t.full == nil +} + +// LanguageTag returns t stripped of regional variant indicators. +// +// At the moment this means it is stripped of a regional and variant subtag "rg" +// and "va" in the "u" extension. +func (t Tag) LanguageTag() Tag { + if t.full == nil { + return Tag{language: t.language, locale: t.language} + } + tt := t.Tag() + tt.SetTypeForKey("rg", "") + tt.SetTypeForKey("va", "") + return Make(tt) +} + +// RegionalTag returns the regional variant of the tag. +// +// At the moment this means that the region is set from the regional subtag +// "rg" in the "u" extension. +func (t Tag) RegionalTag() Tag { + rt := Tag{language: t.locale, locale: t.locale} + if t.full == nil { + return rt + } + b := language.Builder{} + tag := t.Tag() + // tag, _ = tag.SetTypeForKey("rg", "") + b.SetTag(t.locale.Tag()) + if v := tag.Variants(); v != "" { + for _, v := range strings.Split(v, "-") { + b.AddVariant(v) + } + } + for _, e := range tag.Extensions() { + b.AddExt(e) + } + return t +} + +// FromTag reports closest matching ID for an internal language Tag. +func FromTag(t language.Tag) (id ID, exact bool) { + // TODO: perhaps give more frequent tags a lower index. + // TODO: we could make the indexes stable. This will excluded some + // possibilities for optimization, so don't do this quite yet. + exact = true + + b, s, r := t.Raw() + if t.HasString() { + if t.IsPrivateUse() { + // We have no entries for user-defined tags. + return 0, false + } + hasExtra := false + if t.HasVariants() { + if t.HasExtensions() { + build := language.Builder{} + build.SetTag(language.Tag{LangID: b, ScriptID: s, RegionID: r}) + build.AddVariant(t.Variants()) + exact = false + t = build.Make() + } + hasExtra = true + } else if _, ok := t.Extension('u'); ok { + // TODO: va may mean something else. Consider not considering it. + // Strip all but the 'va' entry. + old := t + variant := t.TypeForKey("va") + t = language.Tag{LangID: b, ScriptID: s, RegionID: r} + if variant != "" { + t, _ = t.SetTypeForKey("va", variant) + hasExtra = true + } + exact = old == t + } else { + exact = false + } + if hasExtra { + // We have some variants. + for i, s := range specialTags { + if s == t { + return ID(i + len(coreTags)), exact + } + } + exact = false + } + } + if x, ok := getCoreIndex(t); ok { + return x, exact + } + exact = false + if r != 0 && s == 0 { + // Deal with cases where an extra script is inserted for the region. + t, _ := t.Maximize() + if x, ok := getCoreIndex(t); ok { + return x, exact + } + } + for t = t.Parent(); t != root; t = t.Parent() { + // No variants specified: just compare core components. + // The key has the form lllssrrr, where l, s, and r are nibbles for + // respectively the langID, scriptID, and regionID. + if x, ok := getCoreIndex(t); ok { + return x, exact + } + } + return 0, exact +} + +var root = language.Tag{} diff --git a/vendor/golang.org/x/text/internal/language/compact/parents.go b/vendor/golang.org/x/text/internal/language/compact/parents.go new file mode 100644 index 0000000..8d81072 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/parents.go @@ -0,0 +1,120 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package compact + +// parents maps a compact index of a tag to the compact index of the parent of +// this tag. +var parents = []ID{ // 775 elements + // Entry 0 - 3F + 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0004, 0x0000, 0x0006, + 0x0000, 0x0008, 0x0000, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x0000, + 0x0000, 0x0028, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x0000, + 0x002f, 0x002e, 0x002e, 0x0000, 0x0033, 0x0000, 0x0035, 0x0000, + 0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x0000, 0x003e, + // Entry 40 - 7F + 0x0000, 0x0040, 0x0040, 0x0000, 0x0043, 0x0043, 0x0000, 0x0046, + 0x0000, 0x0048, 0x0000, 0x0000, 0x004b, 0x004a, 0x004a, 0x0000, + 0x004f, 0x004f, 0x004f, 0x004f, 0x0000, 0x0054, 0x0054, 0x0000, + 0x0057, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x005d, + 0x0000, 0x0060, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066, + 0x0066, 0x0000, 0x0069, 0x0000, 0x006b, 0x006b, 0x006b, 0x006b, + 0x006b, 0x006b, 0x006b, 0x0000, 0x0073, 0x0000, 0x0075, 0x0000, + 0x0077, 0x0000, 0x0000, 0x007a, 0x0000, 0x007c, 0x0000, 0x007e, + // Entry 80 - BF + 0x0000, 0x0080, 0x0080, 0x0000, 0x0083, 0x0083, 0x0000, 0x0086, + 0x0087, 0x0087, 0x0087, 0x0086, 0x0088, 0x0087, 0x0087, 0x0087, + 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, 0x0088, 0x0087, + 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0086, + // Entry C0 - FF + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, + 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0086, 0x0087, + 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0000, + 0x00ef, 0x0000, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, + 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f1, 0x00f1, + // Entry 100 - 13F + 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, + 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x0000, 0x010e, + 0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0114, 0x0000, + 0x0117, 0x0117, 0x0117, 0x0117, 0x0000, 0x011c, 0x0000, 0x011e, + 0x0000, 0x0120, 0x0120, 0x0000, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + // Entry 140 - 17F + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156, + 0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x015c, 0x015c, + 0x0000, 0x0160, 0x0000, 0x0000, 0x0163, 0x0000, 0x0165, 0x0000, + 0x0167, 0x0167, 0x0167, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000, + 0x016f, 0x0000, 0x0171, 0x0171, 0x0000, 0x0174, 0x0000, 0x0176, + 0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e, + // Entry 180 - 1BF + 0x0000, 0x0000, 0x0000, 0x0182, 0x0000, 0x0184, 0x0184, 0x0184, + 0x0184, 0x0000, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e, + 0x0000, 0x0000, 0x0191, 0x0000, 0x0000, 0x0000, 0x0195, 0x0000, + 0x0197, 0x0000, 0x0000, 0x019a, 0x0000, 0x0000, 0x019d, 0x0000, + 0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000, + 0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000, + 0x01af, 0x0000, 0x01b1, 0x01b1, 0x0000, 0x01b4, 0x0000, 0x01b6, + 0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x01bc, 0x0000, 0x0000, + // Entry 1C0 - 1FF + 0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000, + 0x01c7, 0x0000, 0x01c9, 0x0000, 0x01cb, 0x01cb, 0x01cb, 0x01cb, + 0x0000, 0x01d0, 0x0000, 0x01d2, 0x01d2, 0x0000, 0x01d5, 0x0000, + 0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x0000, + 0x01df, 0x01df, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6, + 0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee, + 0x0000, 0x01f0, 0x0000, 0x0000, 0x01f3, 0x0000, 0x01f5, 0x01f5, + 0x01f5, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x0000, + // Entry 200 - 23F + 0x01ff, 0x0000, 0x0000, 0x0202, 0x0000, 0x0204, 0x0204, 0x0000, + 0x0207, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x0000, + 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x0000, + 0x0217, 0x0000, 0x0219, 0x0000, 0x021b, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0221, 0x0000, 0x0000, 0x0224, 0x0000, 0x0226, + 0x0226, 0x0000, 0x0229, 0x0000, 0x022b, 0x022b, 0x0000, 0x0000, + 0x022f, 0x022e, 0x022e, 0x0000, 0x0000, 0x0234, 0x0000, 0x0236, + 0x0000, 0x0238, 0x0000, 0x0244, 0x023a, 0x0244, 0x0244, 0x0244, + // Entry 240 - 27F + 0x0244, 0x0244, 0x0244, 0x0244, 0x023a, 0x0244, 0x0244, 0x0000, + 0x0247, 0x0247, 0x0247, 0x0000, 0x024b, 0x0000, 0x024d, 0x0000, + 0x024f, 0x024f, 0x0000, 0x0252, 0x0000, 0x0254, 0x0254, 0x0254, + 0x0254, 0x0254, 0x0254, 0x0000, 0x025b, 0x0000, 0x025d, 0x0000, + 0x025f, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000, + 0x0000, 0x0268, 0x0268, 0x0268, 0x0000, 0x026c, 0x0000, 0x026e, + 0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0274, 0x0273, 0x0273, + 0x0000, 0x0278, 0x0000, 0x027a, 0x0000, 0x027c, 0x0000, 0x0000, + // Entry 280 - 2BF + 0x0000, 0x0000, 0x0281, 0x0000, 0x0000, 0x0284, 0x0000, 0x0286, + 0x0286, 0x0286, 0x0286, 0x0000, 0x028b, 0x028b, 0x028b, 0x0000, + 0x028f, 0x028f, 0x028f, 0x028f, 0x028f, 0x0000, 0x0295, 0x0295, + 0x0295, 0x0295, 0x0000, 0x0000, 0x0000, 0x0000, 0x029d, 0x029d, + 0x029d, 0x0000, 0x02a1, 0x02a1, 0x02a1, 0x02a1, 0x0000, 0x0000, + 0x02a7, 0x02a7, 0x02a7, 0x02a7, 0x0000, 0x02ac, 0x0000, 0x02ae, + 0x02ae, 0x0000, 0x02b1, 0x0000, 0x02b3, 0x0000, 0x02b5, 0x02b5, + 0x0000, 0x0000, 0x02b9, 0x0000, 0x0000, 0x0000, 0x02bd, 0x0000, + // Entry 2C0 - 2FF + 0x02bf, 0x02bf, 0x0000, 0x0000, 0x02c3, 0x0000, 0x02c5, 0x0000, + 0x02c7, 0x0000, 0x02c9, 0x0000, 0x02cb, 0x0000, 0x02cd, 0x02cd, + 0x0000, 0x0000, 0x02d1, 0x0000, 0x02d3, 0x02d0, 0x02d0, 0x0000, + 0x0000, 0x02d8, 0x02d7, 0x02d7, 0x0000, 0x0000, 0x02dd, 0x0000, + 0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6, + 0x0000, 0x0000, 0x02e9, 0x0000, 0x02eb, 0x0000, 0x02ed, 0x0000, + 0x02ef, 0x02ef, 0x0000, 0x0000, 0x02f3, 0x02f2, 0x02f2, 0x0000, + 0x02f7, 0x0000, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x0000, + // Entry 300 - 33F + 0x02ff, 0x0300, 0x02ff, 0x0000, 0x0303, 0x0051, 0x00e6, +} // Size: 1574 bytes + +// Total table size 1574 bytes (1KiB); checksum: 895AAF0B diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go new file mode 100644 index 0000000..a09ed19 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/tables.go @@ -0,0 +1,1015 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package compact + +import "golang.org/x/text/internal/language" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +// NumCompactTags is the number of common tags. The maximum tag is +// NumCompactTags-1. +const NumCompactTags = 775 +const ( + undIndex ID = 0 + afIndex ID = 1 + afNAIndex ID = 2 + afZAIndex ID = 3 + agqIndex ID = 4 + agqCMIndex ID = 5 + akIndex ID = 6 + akGHIndex ID = 7 + amIndex ID = 8 + amETIndex ID = 9 + arIndex ID = 10 + ar001Index ID = 11 + arAEIndex ID = 12 + arBHIndex ID = 13 + arDJIndex ID = 14 + arDZIndex ID = 15 + arEGIndex ID = 16 + arEHIndex ID = 17 + arERIndex ID = 18 + arILIndex ID = 19 + arIQIndex ID = 20 + arJOIndex ID = 21 + arKMIndex ID = 22 + arKWIndex ID = 23 + arLBIndex ID = 24 + arLYIndex ID = 25 + arMAIndex ID = 26 + arMRIndex ID = 27 + arOMIndex ID = 28 + arPSIndex ID = 29 + arQAIndex ID = 30 + arSAIndex ID = 31 + arSDIndex ID = 32 + arSOIndex ID = 33 + arSSIndex ID = 34 + arSYIndex ID = 35 + arTDIndex ID = 36 + arTNIndex ID = 37 + arYEIndex ID = 38 + arsIndex ID = 39 + asIndex ID = 40 + asINIndex ID = 41 + asaIndex ID = 42 + asaTZIndex ID = 43 + astIndex ID = 44 + astESIndex ID = 45 + azIndex ID = 46 + azCyrlIndex ID = 47 + azCyrlAZIndex ID = 48 + azLatnIndex ID = 49 + azLatnAZIndex ID = 50 + basIndex ID = 51 + basCMIndex ID = 52 + beIndex ID = 53 + beBYIndex ID = 54 + bemIndex ID = 55 + bemZMIndex ID = 56 + bezIndex ID = 57 + bezTZIndex ID = 58 + bgIndex ID = 59 + bgBGIndex ID = 60 + bhIndex ID = 61 + bmIndex ID = 62 + bmMLIndex ID = 63 + bnIndex ID = 64 + bnBDIndex ID = 65 + bnINIndex ID = 66 + boIndex ID = 67 + boCNIndex ID = 68 + boINIndex ID = 69 + brIndex ID = 70 + brFRIndex ID = 71 + brxIndex ID = 72 + brxINIndex ID = 73 + bsIndex ID = 74 + bsCyrlIndex ID = 75 + bsCyrlBAIndex ID = 76 + bsLatnIndex ID = 77 + bsLatnBAIndex ID = 78 + caIndex ID = 79 + caADIndex ID = 80 + caESIndex ID = 81 + caFRIndex ID = 82 + caITIndex ID = 83 + ccpIndex ID = 84 + ccpBDIndex ID = 85 + ccpINIndex ID = 86 + ceIndex ID = 87 + ceRUIndex ID = 88 + cggIndex ID = 89 + cggUGIndex ID = 90 + chrIndex ID = 91 + chrUSIndex ID = 92 + ckbIndex ID = 93 + ckbIQIndex ID = 94 + ckbIRIndex ID = 95 + csIndex ID = 96 + csCZIndex ID = 97 + cuIndex ID = 98 + cuRUIndex ID = 99 + cyIndex ID = 100 + cyGBIndex ID = 101 + daIndex ID = 102 + daDKIndex ID = 103 + daGLIndex ID = 104 + davIndex ID = 105 + davKEIndex ID = 106 + deIndex ID = 107 + deATIndex ID = 108 + deBEIndex ID = 109 + deCHIndex ID = 110 + deDEIndex ID = 111 + deITIndex ID = 112 + deLIIndex ID = 113 + deLUIndex ID = 114 + djeIndex ID = 115 + djeNEIndex ID = 116 + dsbIndex ID = 117 + dsbDEIndex ID = 118 + duaIndex ID = 119 + duaCMIndex ID = 120 + dvIndex ID = 121 + dyoIndex ID = 122 + dyoSNIndex ID = 123 + dzIndex ID = 124 + dzBTIndex ID = 125 + ebuIndex ID = 126 + ebuKEIndex ID = 127 + eeIndex ID = 128 + eeGHIndex ID = 129 + eeTGIndex ID = 130 + elIndex ID = 131 + elCYIndex ID = 132 + elGRIndex ID = 133 + enIndex ID = 134 + en001Index ID = 135 + en150Index ID = 136 + enAGIndex ID = 137 + enAIIndex ID = 138 + enASIndex ID = 139 + enATIndex ID = 140 + enAUIndex ID = 141 + enBBIndex ID = 142 + enBEIndex ID = 143 + enBIIndex ID = 144 + enBMIndex ID = 145 + enBSIndex ID = 146 + enBWIndex ID = 147 + enBZIndex ID = 148 + enCAIndex ID = 149 + enCCIndex ID = 150 + enCHIndex ID = 151 + enCKIndex ID = 152 + enCMIndex ID = 153 + enCXIndex ID = 154 + enCYIndex ID = 155 + enDEIndex ID = 156 + enDGIndex ID = 157 + enDKIndex ID = 158 + enDMIndex ID = 159 + enERIndex ID = 160 + enFIIndex ID = 161 + enFJIndex ID = 162 + enFKIndex ID = 163 + enFMIndex ID = 164 + enGBIndex ID = 165 + enGDIndex ID = 166 + enGGIndex ID = 167 + enGHIndex ID = 168 + enGIIndex ID = 169 + enGMIndex ID = 170 + enGUIndex ID = 171 + enGYIndex ID = 172 + enHKIndex ID = 173 + enIEIndex ID = 174 + enILIndex ID = 175 + enIMIndex ID = 176 + enINIndex ID = 177 + enIOIndex ID = 178 + enJEIndex ID = 179 + enJMIndex ID = 180 + enKEIndex ID = 181 + enKIIndex ID = 182 + enKNIndex ID = 183 + enKYIndex ID = 184 + enLCIndex ID = 185 + enLRIndex ID = 186 + enLSIndex ID = 187 + enMGIndex ID = 188 + enMHIndex ID = 189 + enMOIndex ID = 190 + enMPIndex ID = 191 + enMSIndex ID = 192 + enMTIndex ID = 193 + enMUIndex ID = 194 + enMWIndex ID = 195 + enMYIndex ID = 196 + enNAIndex ID = 197 + enNFIndex ID = 198 + enNGIndex ID = 199 + enNLIndex ID = 200 + enNRIndex ID = 201 + enNUIndex ID = 202 + enNZIndex ID = 203 + enPGIndex ID = 204 + enPHIndex ID = 205 + enPKIndex ID = 206 + enPNIndex ID = 207 + enPRIndex ID = 208 + enPWIndex ID = 209 + enRWIndex ID = 210 + enSBIndex ID = 211 + enSCIndex ID = 212 + enSDIndex ID = 213 + enSEIndex ID = 214 + enSGIndex ID = 215 + enSHIndex ID = 216 + enSIIndex ID = 217 + enSLIndex ID = 218 + enSSIndex ID = 219 + enSXIndex ID = 220 + enSZIndex ID = 221 + enTCIndex ID = 222 + enTKIndex ID = 223 + enTOIndex ID = 224 + enTTIndex ID = 225 + enTVIndex ID = 226 + enTZIndex ID = 227 + enUGIndex ID = 228 + enUMIndex ID = 229 + enUSIndex ID = 230 + enVCIndex ID = 231 + enVGIndex ID = 232 + enVIIndex ID = 233 + enVUIndex ID = 234 + enWSIndex ID = 235 + enZAIndex ID = 236 + enZMIndex ID = 237 + enZWIndex ID = 238 + eoIndex ID = 239 + eo001Index ID = 240 + esIndex ID = 241 + es419Index ID = 242 + esARIndex ID = 243 + esBOIndex ID = 244 + esBRIndex ID = 245 + esBZIndex ID = 246 + esCLIndex ID = 247 + esCOIndex ID = 248 + esCRIndex ID = 249 + esCUIndex ID = 250 + esDOIndex ID = 251 + esEAIndex ID = 252 + esECIndex ID = 253 + esESIndex ID = 254 + esGQIndex ID = 255 + esGTIndex ID = 256 + esHNIndex ID = 257 + esICIndex ID = 258 + esMXIndex ID = 259 + esNIIndex ID = 260 + esPAIndex ID = 261 + esPEIndex ID = 262 + esPHIndex ID = 263 + esPRIndex ID = 264 + esPYIndex ID = 265 + esSVIndex ID = 266 + esUSIndex ID = 267 + esUYIndex ID = 268 + esVEIndex ID = 269 + etIndex ID = 270 + etEEIndex ID = 271 + euIndex ID = 272 + euESIndex ID = 273 + ewoIndex ID = 274 + ewoCMIndex ID = 275 + faIndex ID = 276 + faAFIndex ID = 277 + faIRIndex ID = 278 + ffIndex ID = 279 + ffCMIndex ID = 280 + ffGNIndex ID = 281 + ffMRIndex ID = 282 + ffSNIndex ID = 283 + fiIndex ID = 284 + fiFIIndex ID = 285 + filIndex ID = 286 + filPHIndex ID = 287 + foIndex ID = 288 + foDKIndex ID = 289 + foFOIndex ID = 290 + frIndex ID = 291 + frBEIndex ID = 292 + frBFIndex ID = 293 + frBIIndex ID = 294 + frBJIndex ID = 295 + frBLIndex ID = 296 + frCAIndex ID = 297 + frCDIndex ID = 298 + frCFIndex ID = 299 + frCGIndex ID = 300 + frCHIndex ID = 301 + frCIIndex ID = 302 + frCMIndex ID = 303 + frDJIndex ID = 304 + frDZIndex ID = 305 + frFRIndex ID = 306 + frGAIndex ID = 307 + frGFIndex ID = 308 + frGNIndex ID = 309 + frGPIndex ID = 310 + frGQIndex ID = 311 + frHTIndex ID = 312 + frKMIndex ID = 313 + frLUIndex ID = 314 + frMAIndex ID = 315 + frMCIndex ID = 316 + frMFIndex ID = 317 + frMGIndex ID = 318 + frMLIndex ID = 319 + frMQIndex ID = 320 + frMRIndex ID = 321 + frMUIndex ID = 322 + frNCIndex ID = 323 + frNEIndex ID = 324 + frPFIndex ID = 325 + frPMIndex ID = 326 + frREIndex ID = 327 + frRWIndex ID = 328 + frSCIndex ID = 329 + frSNIndex ID = 330 + frSYIndex ID = 331 + frTDIndex ID = 332 + frTGIndex ID = 333 + frTNIndex ID = 334 + frVUIndex ID = 335 + frWFIndex ID = 336 + frYTIndex ID = 337 + furIndex ID = 338 + furITIndex ID = 339 + fyIndex ID = 340 + fyNLIndex ID = 341 + gaIndex ID = 342 + gaIEIndex ID = 343 + gdIndex ID = 344 + gdGBIndex ID = 345 + glIndex ID = 346 + glESIndex ID = 347 + gswIndex ID = 348 + gswCHIndex ID = 349 + gswFRIndex ID = 350 + gswLIIndex ID = 351 + guIndex ID = 352 + guINIndex ID = 353 + guwIndex ID = 354 + guzIndex ID = 355 + guzKEIndex ID = 356 + gvIndex ID = 357 + gvIMIndex ID = 358 + haIndex ID = 359 + haGHIndex ID = 360 + haNEIndex ID = 361 + haNGIndex ID = 362 + hawIndex ID = 363 + hawUSIndex ID = 364 + heIndex ID = 365 + heILIndex ID = 366 + hiIndex ID = 367 + hiINIndex ID = 368 + hrIndex ID = 369 + hrBAIndex ID = 370 + hrHRIndex ID = 371 + hsbIndex ID = 372 + hsbDEIndex ID = 373 + huIndex ID = 374 + huHUIndex ID = 375 + hyIndex ID = 376 + hyAMIndex ID = 377 + idIndex ID = 378 + idIDIndex ID = 379 + igIndex ID = 380 + igNGIndex ID = 381 + iiIndex ID = 382 + iiCNIndex ID = 383 + inIndex ID = 384 + ioIndex ID = 385 + isIndex ID = 386 + isISIndex ID = 387 + itIndex ID = 388 + itCHIndex ID = 389 + itITIndex ID = 390 + itSMIndex ID = 391 + itVAIndex ID = 392 + iuIndex ID = 393 + iwIndex ID = 394 + jaIndex ID = 395 + jaJPIndex ID = 396 + jboIndex ID = 397 + jgoIndex ID = 398 + jgoCMIndex ID = 399 + jiIndex ID = 400 + jmcIndex ID = 401 + jmcTZIndex ID = 402 + jvIndex ID = 403 + jwIndex ID = 404 + kaIndex ID = 405 + kaGEIndex ID = 406 + kabIndex ID = 407 + kabDZIndex ID = 408 + kajIndex ID = 409 + kamIndex ID = 410 + kamKEIndex ID = 411 + kcgIndex ID = 412 + kdeIndex ID = 413 + kdeTZIndex ID = 414 + keaIndex ID = 415 + keaCVIndex ID = 416 + khqIndex ID = 417 + khqMLIndex ID = 418 + kiIndex ID = 419 + kiKEIndex ID = 420 + kkIndex ID = 421 + kkKZIndex ID = 422 + kkjIndex ID = 423 + kkjCMIndex ID = 424 + klIndex ID = 425 + klGLIndex ID = 426 + klnIndex ID = 427 + klnKEIndex ID = 428 + kmIndex ID = 429 + kmKHIndex ID = 430 + knIndex ID = 431 + knINIndex ID = 432 + koIndex ID = 433 + koKPIndex ID = 434 + koKRIndex ID = 435 + kokIndex ID = 436 + kokINIndex ID = 437 + ksIndex ID = 438 + ksINIndex ID = 439 + ksbIndex ID = 440 + ksbTZIndex ID = 441 + ksfIndex ID = 442 + ksfCMIndex ID = 443 + kshIndex ID = 444 + kshDEIndex ID = 445 + kuIndex ID = 446 + kwIndex ID = 447 + kwGBIndex ID = 448 + kyIndex ID = 449 + kyKGIndex ID = 450 + lagIndex ID = 451 + lagTZIndex ID = 452 + lbIndex ID = 453 + lbLUIndex ID = 454 + lgIndex ID = 455 + lgUGIndex ID = 456 + lktIndex ID = 457 + lktUSIndex ID = 458 + lnIndex ID = 459 + lnAOIndex ID = 460 + lnCDIndex ID = 461 + lnCFIndex ID = 462 + lnCGIndex ID = 463 + loIndex ID = 464 + loLAIndex ID = 465 + lrcIndex ID = 466 + lrcIQIndex ID = 467 + lrcIRIndex ID = 468 + ltIndex ID = 469 + ltLTIndex ID = 470 + luIndex ID = 471 + luCDIndex ID = 472 + luoIndex ID = 473 + luoKEIndex ID = 474 + luyIndex ID = 475 + luyKEIndex ID = 476 + lvIndex ID = 477 + lvLVIndex ID = 478 + masIndex ID = 479 + masKEIndex ID = 480 + masTZIndex ID = 481 + merIndex ID = 482 + merKEIndex ID = 483 + mfeIndex ID = 484 + mfeMUIndex ID = 485 + mgIndex ID = 486 + mgMGIndex ID = 487 + mghIndex ID = 488 + mghMZIndex ID = 489 + mgoIndex ID = 490 + mgoCMIndex ID = 491 + mkIndex ID = 492 + mkMKIndex ID = 493 + mlIndex ID = 494 + mlINIndex ID = 495 + mnIndex ID = 496 + mnMNIndex ID = 497 + moIndex ID = 498 + mrIndex ID = 499 + mrINIndex ID = 500 + msIndex ID = 501 + msBNIndex ID = 502 + msMYIndex ID = 503 + msSGIndex ID = 504 + mtIndex ID = 505 + mtMTIndex ID = 506 + muaIndex ID = 507 + muaCMIndex ID = 508 + myIndex ID = 509 + myMMIndex ID = 510 + mznIndex ID = 511 + mznIRIndex ID = 512 + nahIndex ID = 513 + naqIndex ID = 514 + naqNAIndex ID = 515 + nbIndex ID = 516 + nbNOIndex ID = 517 + nbSJIndex ID = 518 + ndIndex ID = 519 + ndZWIndex ID = 520 + ndsIndex ID = 521 + ndsDEIndex ID = 522 + ndsNLIndex ID = 523 + neIndex ID = 524 + neINIndex ID = 525 + neNPIndex ID = 526 + nlIndex ID = 527 + nlAWIndex ID = 528 + nlBEIndex ID = 529 + nlBQIndex ID = 530 + nlCWIndex ID = 531 + nlNLIndex ID = 532 + nlSRIndex ID = 533 + nlSXIndex ID = 534 + nmgIndex ID = 535 + nmgCMIndex ID = 536 + nnIndex ID = 537 + nnNOIndex ID = 538 + nnhIndex ID = 539 + nnhCMIndex ID = 540 + noIndex ID = 541 + nqoIndex ID = 542 + nrIndex ID = 543 + nsoIndex ID = 544 + nusIndex ID = 545 + nusSSIndex ID = 546 + nyIndex ID = 547 + nynIndex ID = 548 + nynUGIndex ID = 549 + omIndex ID = 550 + omETIndex ID = 551 + omKEIndex ID = 552 + orIndex ID = 553 + orINIndex ID = 554 + osIndex ID = 555 + osGEIndex ID = 556 + osRUIndex ID = 557 + paIndex ID = 558 + paArabIndex ID = 559 + paArabPKIndex ID = 560 + paGuruIndex ID = 561 + paGuruINIndex ID = 562 + papIndex ID = 563 + plIndex ID = 564 + plPLIndex ID = 565 + prgIndex ID = 566 + prg001Index ID = 567 + psIndex ID = 568 + psAFIndex ID = 569 + ptIndex ID = 570 + ptAOIndex ID = 571 + ptBRIndex ID = 572 + ptCHIndex ID = 573 + ptCVIndex ID = 574 + ptGQIndex ID = 575 + ptGWIndex ID = 576 + ptLUIndex ID = 577 + ptMOIndex ID = 578 + ptMZIndex ID = 579 + ptPTIndex ID = 580 + ptSTIndex ID = 581 + ptTLIndex ID = 582 + quIndex ID = 583 + quBOIndex ID = 584 + quECIndex ID = 585 + quPEIndex ID = 586 + rmIndex ID = 587 + rmCHIndex ID = 588 + rnIndex ID = 589 + rnBIIndex ID = 590 + roIndex ID = 591 + roMDIndex ID = 592 + roROIndex ID = 593 + rofIndex ID = 594 + rofTZIndex ID = 595 + ruIndex ID = 596 + ruBYIndex ID = 597 + ruKGIndex ID = 598 + ruKZIndex ID = 599 + ruMDIndex ID = 600 + ruRUIndex ID = 601 + ruUAIndex ID = 602 + rwIndex ID = 603 + rwRWIndex ID = 604 + rwkIndex ID = 605 + rwkTZIndex ID = 606 + sahIndex ID = 607 + sahRUIndex ID = 608 + saqIndex ID = 609 + saqKEIndex ID = 610 + sbpIndex ID = 611 + sbpTZIndex ID = 612 + sdIndex ID = 613 + sdPKIndex ID = 614 + sdhIndex ID = 615 + seIndex ID = 616 + seFIIndex ID = 617 + seNOIndex ID = 618 + seSEIndex ID = 619 + sehIndex ID = 620 + sehMZIndex ID = 621 + sesIndex ID = 622 + sesMLIndex ID = 623 + sgIndex ID = 624 + sgCFIndex ID = 625 + shIndex ID = 626 + shiIndex ID = 627 + shiLatnIndex ID = 628 + shiLatnMAIndex ID = 629 + shiTfngIndex ID = 630 + shiTfngMAIndex ID = 631 + siIndex ID = 632 + siLKIndex ID = 633 + skIndex ID = 634 + skSKIndex ID = 635 + slIndex ID = 636 + slSIIndex ID = 637 + smaIndex ID = 638 + smiIndex ID = 639 + smjIndex ID = 640 + smnIndex ID = 641 + smnFIIndex ID = 642 + smsIndex ID = 643 + snIndex ID = 644 + snZWIndex ID = 645 + soIndex ID = 646 + soDJIndex ID = 647 + soETIndex ID = 648 + soKEIndex ID = 649 + soSOIndex ID = 650 + sqIndex ID = 651 + sqALIndex ID = 652 + sqMKIndex ID = 653 + sqXKIndex ID = 654 + srIndex ID = 655 + srCyrlIndex ID = 656 + srCyrlBAIndex ID = 657 + srCyrlMEIndex ID = 658 + srCyrlRSIndex ID = 659 + srCyrlXKIndex ID = 660 + srLatnIndex ID = 661 + srLatnBAIndex ID = 662 + srLatnMEIndex ID = 663 + srLatnRSIndex ID = 664 + srLatnXKIndex ID = 665 + ssIndex ID = 666 + ssyIndex ID = 667 + stIndex ID = 668 + svIndex ID = 669 + svAXIndex ID = 670 + svFIIndex ID = 671 + svSEIndex ID = 672 + swIndex ID = 673 + swCDIndex ID = 674 + swKEIndex ID = 675 + swTZIndex ID = 676 + swUGIndex ID = 677 + syrIndex ID = 678 + taIndex ID = 679 + taINIndex ID = 680 + taLKIndex ID = 681 + taMYIndex ID = 682 + taSGIndex ID = 683 + teIndex ID = 684 + teINIndex ID = 685 + teoIndex ID = 686 + teoKEIndex ID = 687 + teoUGIndex ID = 688 + tgIndex ID = 689 + tgTJIndex ID = 690 + thIndex ID = 691 + thTHIndex ID = 692 + tiIndex ID = 693 + tiERIndex ID = 694 + tiETIndex ID = 695 + tigIndex ID = 696 + tkIndex ID = 697 + tkTMIndex ID = 698 + tlIndex ID = 699 + tnIndex ID = 700 + toIndex ID = 701 + toTOIndex ID = 702 + trIndex ID = 703 + trCYIndex ID = 704 + trTRIndex ID = 705 + tsIndex ID = 706 + ttIndex ID = 707 + ttRUIndex ID = 708 + twqIndex ID = 709 + twqNEIndex ID = 710 + tzmIndex ID = 711 + tzmMAIndex ID = 712 + ugIndex ID = 713 + ugCNIndex ID = 714 + ukIndex ID = 715 + ukUAIndex ID = 716 + urIndex ID = 717 + urINIndex ID = 718 + urPKIndex ID = 719 + uzIndex ID = 720 + uzArabIndex ID = 721 + uzArabAFIndex ID = 722 + uzCyrlIndex ID = 723 + uzCyrlUZIndex ID = 724 + uzLatnIndex ID = 725 + uzLatnUZIndex ID = 726 + vaiIndex ID = 727 + vaiLatnIndex ID = 728 + vaiLatnLRIndex ID = 729 + vaiVaiiIndex ID = 730 + vaiVaiiLRIndex ID = 731 + veIndex ID = 732 + viIndex ID = 733 + viVNIndex ID = 734 + voIndex ID = 735 + vo001Index ID = 736 + vunIndex ID = 737 + vunTZIndex ID = 738 + waIndex ID = 739 + waeIndex ID = 740 + waeCHIndex ID = 741 + woIndex ID = 742 + woSNIndex ID = 743 + xhIndex ID = 744 + xogIndex ID = 745 + xogUGIndex ID = 746 + yavIndex ID = 747 + yavCMIndex ID = 748 + yiIndex ID = 749 + yi001Index ID = 750 + yoIndex ID = 751 + yoBJIndex ID = 752 + yoNGIndex ID = 753 + yueIndex ID = 754 + yueHansIndex ID = 755 + yueHansCNIndex ID = 756 + yueHantIndex ID = 757 + yueHantHKIndex ID = 758 + zghIndex ID = 759 + zghMAIndex ID = 760 + zhIndex ID = 761 + zhHansIndex ID = 762 + zhHansCNIndex ID = 763 + zhHansHKIndex ID = 764 + zhHansMOIndex ID = 765 + zhHansSGIndex ID = 766 + zhHantIndex ID = 767 + zhHantHKIndex ID = 768 + zhHantMOIndex ID = 769 + zhHantTWIndex ID = 770 + zuIndex ID = 771 + zuZAIndex ID = 772 + caESvalenciaIndex ID = 773 + enUSuvaposixIndex ID = 774 +) + +var coreTags = []language.CompactCoreInfo{ // 773 elements + // Entry 0 - 1F + 0x00000000, 0x01600000, 0x016000d3, 0x01600162, + 0x01c00000, 0x01c00052, 0x02100000, 0x02100081, + 0x02700000, 0x02700070, 0x03a00000, 0x03a00001, + 0x03a00023, 0x03a00039, 0x03a00063, 0x03a00068, + 0x03a0006c, 0x03a0006d, 0x03a0006e, 0x03a00098, + 0x03a0009c, 0x03a000a2, 0x03a000a9, 0x03a000ad, + 0x03a000b1, 0x03a000ba, 0x03a000bb, 0x03a000ca, + 0x03a000e2, 0x03a000ee, 0x03a000f4, 0x03a00109, + // Entry 20 - 3F + 0x03a0010c, 0x03a00116, 0x03a00118, 0x03a0011d, + 0x03a00121, 0x03a00129, 0x03a0015f, 0x04000000, + 0x04300000, 0x0430009a, 0x04400000, 0x04400130, + 0x04800000, 0x0480006f, 0x05800000, 0x05820000, + 0x05820032, 0x0585b000, 0x0585b032, 0x05e00000, + 0x05e00052, 0x07100000, 0x07100047, 0x07500000, + 0x07500163, 0x07900000, 0x07900130, 0x07e00000, + 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c4, + // Entry 40 - 5F + 0x0a500000, 0x0a500035, 0x0a50009a, 0x0a900000, + 0x0a900053, 0x0a90009a, 0x0b200000, 0x0b200079, + 0x0b500000, 0x0b50009a, 0x0b700000, 0x0b720000, + 0x0b720033, 0x0b75b000, 0x0b75b033, 0x0d700000, + 0x0d700022, 0x0d70006f, 0x0d700079, 0x0d70009f, + 0x0db00000, 0x0db00035, 0x0db0009a, 0x0dc00000, + 0x0dc00107, 0x0df00000, 0x0df00132, 0x0e500000, + 0x0e500136, 0x0e900000, 0x0e90009c, 0x0e90009d, + // Entry 60 - 7F + 0x0fa00000, 0x0fa0005f, 0x0fe00000, 0x0fe00107, + 0x10000000, 0x1000007c, 0x10100000, 0x10100064, + 0x10100083, 0x10800000, 0x108000a5, 0x10d00000, + 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00061, + 0x10d0009f, 0x10d000b3, 0x10d000b8, 0x11700000, + 0x117000d5, 0x11f00000, 0x11f00061, 0x12400000, + 0x12400052, 0x12800000, 0x12b00000, 0x12b00115, + 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a5, + // Entry 80 - 9F + 0x13000000, 0x13000081, 0x13000123, 0x13600000, + 0x1360005e, 0x13600088, 0x13900000, 0x13900001, + 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, + 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, + 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, + 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, + 0x13900050, 0x13900052, 0x1390005d, 0x1390005e, + 0x13900061, 0x13900062, 0x13900064, 0x13900065, + // Entry A0 - BF + 0x1390006e, 0x13900073, 0x13900074, 0x13900075, + 0x13900076, 0x1390007c, 0x1390007d, 0x13900080, + 0x13900081, 0x13900082, 0x13900084, 0x1390008b, + 0x1390008d, 0x1390008e, 0x13900097, 0x13900098, + 0x13900099, 0x1390009a, 0x1390009b, 0x139000a0, + 0x139000a1, 0x139000a5, 0x139000a8, 0x139000aa, + 0x139000ae, 0x139000b2, 0x139000b5, 0x139000b6, + 0x139000c0, 0x139000c1, 0x139000c7, 0x139000c8, + // Entry C0 - DF + 0x139000cb, 0x139000cc, 0x139000cd, 0x139000cf, + 0x139000d1, 0x139000d3, 0x139000d6, 0x139000d7, + 0x139000da, 0x139000de, 0x139000e0, 0x139000e1, + 0x139000e7, 0x139000e8, 0x139000e9, 0x139000ec, + 0x139000ed, 0x139000f1, 0x13900108, 0x1390010a, + 0x1390010b, 0x1390010c, 0x1390010d, 0x1390010e, + 0x1390010f, 0x13900110, 0x13900113, 0x13900118, + 0x1390011c, 0x1390011e, 0x13900120, 0x13900126, + // Entry E0 - FF + 0x1390012a, 0x1390012d, 0x1390012e, 0x13900130, + 0x13900132, 0x13900134, 0x13900136, 0x1390013a, + 0x1390013d, 0x1390013e, 0x13900140, 0x13900143, + 0x13900162, 0x13900163, 0x13900165, 0x13c00000, + 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, + 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, + 0x13e00054, 0x13e00057, 0x13e0005a, 0x13e00066, + 0x13e00069, 0x13e0006a, 0x13e0006f, 0x13e00087, + // Entry 100 - 11F + 0x13e0008a, 0x13e00090, 0x13e00095, 0x13e000d0, + 0x13e000d9, 0x13e000e3, 0x13e000e5, 0x13e000e8, + 0x13e000ed, 0x13e000f2, 0x13e0011b, 0x13e00136, + 0x13e00137, 0x13e0013c, 0x14000000, 0x1400006b, + 0x14500000, 0x1450006f, 0x14600000, 0x14600052, + 0x14800000, 0x14800024, 0x1480009d, 0x14e00000, + 0x14e00052, 0x14e00085, 0x14e000ca, 0x14e00115, + 0x15100000, 0x15100073, 0x15300000, 0x153000e8, + // Entry 120 - 13F + 0x15800000, 0x15800064, 0x15800077, 0x15e00000, + 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, + 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, + 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, + 0x15e00063, 0x15e00068, 0x15e00079, 0x15e0007b, + 0x15e0007f, 0x15e00085, 0x15e00086, 0x15e00087, + 0x15e00092, 0x15e000a9, 0x15e000b8, 0x15e000bb, + 0x15e000bc, 0x15e000bf, 0x15e000c0, 0x15e000c4, + // Entry 140 - 15F + 0x15e000c9, 0x15e000ca, 0x15e000cd, 0x15e000d4, + 0x15e000d5, 0x15e000e6, 0x15e000eb, 0x15e00103, + 0x15e00108, 0x15e0010b, 0x15e00115, 0x15e0011d, + 0x15e00121, 0x15e00123, 0x15e00129, 0x15e00140, + 0x15e00141, 0x15e00160, 0x16900000, 0x1690009f, + 0x16d00000, 0x16d000da, 0x16e00000, 0x16e00097, + 0x17e00000, 0x17e0007c, 0x19000000, 0x1900006f, + 0x1a300000, 0x1a30004e, 0x1a300079, 0x1a3000b3, + // Entry 160 - 17F + 0x1a400000, 0x1a40009a, 0x1a900000, 0x1ab00000, + 0x1ab000a5, 0x1ac00000, 0x1ac00099, 0x1b400000, + 0x1b400081, 0x1b4000d5, 0x1b4000d7, 0x1b800000, + 0x1b800136, 0x1bc00000, 0x1bc00098, 0x1be00000, + 0x1be0009a, 0x1d100000, 0x1d100033, 0x1d100091, + 0x1d200000, 0x1d200061, 0x1d500000, 0x1d500093, + 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100096, + 0x1e700000, 0x1e7000d7, 0x1ea00000, 0x1ea00053, + // Entry 180 - 19F + 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009e, + 0x1f900000, 0x1f90004e, 0x1f90009f, 0x1f900114, + 0x1f900139, 0x1fa00000, 0x1fb00000, 0x20000000, + 0x200000a3, 0x20300000, 0x20700000, 0x20700052, + 0x20800000, 0x20a00000, 0x20a00130, 0x20e00000, + 0x20f00000, 0x21000000, 0x2100007e, 0x21200000, + 0x21200068, 0x21600000, 0x21700000, 0x217000a5, + 0x21f00000, 0x22300000, 0x22300130, 0x22700000, + // Entry 1A0 - 1BF + 0x2270005b, 0x23400000, 0x234000c4, 0x23900000, + 0x239000a5, 0x24200000, 0x242000af, 0x24400000, + 0x24400052, 0x24500000, 0x24500083, 0x24600000, + 0x246000a5, 0x24a00000, 0x24a000a7, 0x25100000, + 0x2510009a, 0x25400000, 0x254000ab, 0x254000ac, + 0x25600000, 0x2560009a, 0x26a00000, 0x26a0009a, + 0x26b00000, 0x26b00130, 0x26d00000, 0x26d00052, + 0x26e00000, 0x26e00061, 0x27400000, 0x28100000, + // Entry 1C0 - 1DF + 0x2810007c, 0x28a00000, 0x28a000a6, 0x29100000, + 0x29100130, 0x29500000, 0x295000b8, 0x2a300000, + 0x2a300132, 0x2af00000, 0x2af00136, 0x2b500000, + 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, + 0x2b800000, 0x2b8000b0, 0x2bf00000, 0x2bf0009c, + 0x2bf0009d, 0x2c000000, 0x2c0000b7, 0x2c200000, + 0x2c20004b, 0x2c400000, 0x2c4000a5, 0x2c500000, + 0x2c5000a5, 0x2c700000, 0x2c7000b9, 0x2d100000, + // Entry 1E0 - 1FF + 0x2d1000a5, 0x2d100130, 0x2e900000, 0x2e9000a5, + 0x2ed00000, 0x2ed000cd, 0x2f100000, 0x2f1000c0, + 0x2f200000, 0x2f2000d2, 0x2f400000, 0x2f400052, + 0x2ff00000, 0x2ff000c3, 0x30400000, 0x3040009a, + 0x30b00000, 0x30b000c6, 0x31000000, 0x31b00000, + 0x31b0009a, 0x31f00000, 0x31f0003e, 0x31f000d1, + 0x31f0010e, 0x32000000, 0x320000cc, 0x32500000, + 0x32500052, 0x33100000, 0x331000c5, 0x33a00000, + // Entry 200 - 21F + 0x33a0009d, 0x34100000, 0x34500000, 0x345000d3, + 0x34700000, 0x347000db, 0x34700111, 0x34e00000, + 0x34e00165, 0x35000000, 0x35000061, 0x350000da, + 0x35100000, 0x3510009a, 0x351000dc, 0x36700000, + 0x36700030, 0x36700036, 0x36700040, 0x3670005c, + 0x367000da, 0x36700117, 0x3670011c, 0x36800000, + 0x36800052, 0x36a00000, 0x36a000db, 0x36c00000, + 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, + // Entry 220 - 23F + 0x37a00000, 0x38000000, 0x38000118, 0x38700000, + 0x38900000, 0x38900132, 0x39000000, 0x39000070, + 0x390000a5, 0x39500000, 0x3950009a, 0x39800000, + 0x3980007e, 0x39800107, 0x39d00000, 0x39d05000, + 0x39d050e9, 0x39d36000, 0x39d3609a, 0x3a100000, + 0x3b300000, 0x3b3000ea, 0x3bd00000, 0x3bd00001, + 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, + 0x3c000041, 0x3c00004e, 0x3c00005b, 0x3c000087, + // Entry 240 - 25F + 0x3c00008c, 0x3c0000b8, 0x3c0000c7, 0x3c0000d2, + 0x3c0000ef, 0x3c000119, 0x3c000127, 0x3c400000, + 0x3c40003f, 0x3c40006a, 0x3c4000e5, 0x3d400000, + 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, + 0x3dc000bd, 0x3dc00105, 0x3de00000, 0x3de00130, + 0x3e200000, 0x3e200047, 0x3e2000a6, 0x3e2000af, + 0x3e2000bd, 0x3e200107, 0x3e200131, 0x3e500000, + 0x3e500108, 0x3e600000, 0x3e600130, 0x3eb00000, + // Entry 260 - 27F + 0x3eb00107, 0x3ec00000, 0x3ec000a5, 0x3f300000, + 0x3f300130, 0x3fa00000, 0x3fa000e9, 0x3fc00000, + 0x3fd00000, 0x3fd00073, 0x3fd000db, 0x3fd0010d, + 0x3ff00000, 0x3ff000d2, 0x40100000, 0x401000c4, + 0x40200000, 0x4020004c, 0x40700000, 0x40800000, + 0x4085b000, 0x4085b0bb, 0x408eb000, 0x408eb0bb, + 0x40c00000, 0x40c000b4, 0x41200000, 0x41200112, + 0x41600000, 0x41600110, 0x41c00000, 0x41d00000, + // Entry 280 - 29F + 0x41e00000, 0x41f00000, 0x41f00073, 0x42200000, + 0x42300000, 0x42300165, 0x42900000, 0x42900063, + 0x42900070, 0x429000a5, 0x42900116, 0x43100000, + 0x43100027, 0x431000c3, 0x4310014e, 0x43200000, + 0x43220000, 0x43220033, 0x432200be, 0x43220106, + 0x4322014e, 0x4325b000, 0x4325b033, 0x4325b0be, + 0x4325b106, 0x4325b14e, 0x43700000, 0x43a00000, + 0x43b00000, 0x44400000, 0x44400031, 0x44400073, + // Entry 2A0 - 2BF + 0x4440010d, 0x44500000, 0x4450004b, 0x445000a5, + 0x44500130, 0x44500132, 0x44e00000, 0x45000000, + 0x4500009a, 0x450000b4, 0x450000d1, 0x4500010e, + 0x46100000, 0x4610009a, 0x46400000, 0x464000a5, + 0x46400132, 0x46700000, 0x46700125, 0x46b00000, + 0x46b00124, 0x46f00000, 0x46f0006e, 0x46f00070, + 0x47100000, 0x47600000, 0x47600128, 0x47a00000, + 0x48000000, 0x48200000, 0x4820012a, 0x48a00000, + // Entry 2C0 - 2DF + 0x48a0005e, 0x48a0012c, 0x48e00000, 0x49400000, + 0x49400107, 0x4a400000, 0x4a4000d5, 0x4a900000, + 0x4a9000bb, 0x4ac00000, 0x4ac00053, 0x4ae00000, + 0x4ae00131, 0x4b400000, 0x4b40009a, 0x4b4000e9, + 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000, + 0x4bc20138, 0x4bc5b000, 0x4bc5b138, 0x4be00000, + 0x4be5b000, 0x4be5b0b5, 0x4bef4000, 0x4bef40b5, + 0x4c000000, 0x4c300000, 0x4c30013f, 0x4c900000, + // Entry 2E0 - 2FF + 0x4c900001, 0x4cc00000, 0x4cc00130, 0x4ce00000, + 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500115, + 0x4f200000, 0x4fb00000, 0x4fb00132, 0x50900000, + 0x50900052, 0x51200000, 0x51200001, 0x51800000, + 0x5180003b, 0x518000d7, 0x51f00000, 0x51f3b000, + 0x51f3b053, 0x51f3c000, 0x51f3c08e, 0x52800000, + 0x528000bb, 0x52900000, 0x5293b000, 0x5293b053, + 0x5293b08e, 0x5293b0c7, 0x5293b10e, 0x5293c000, + // Entry 300 - 31F + 0x5293c08e, 0x5293c0c7, 0x5293c12f, 0x52f00000, + 0x52f00162, +} // Size: 3116 bytes + +const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" + +// Total table size 3147 bytes (3KiB); checksum: 5A8FFFA5 diff --git a/vendor/golang.org/x/text/internal/language/compact/tags.go b/vendor/golang.org/x/text/internal/language/compact/tags.go new file mode 100644 index 0000000..ca135d2 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/tags.go @@ -0,0 +1,91 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package compact + +var ( + und = Tag{} + + Und Tag = Tag{} + + Afrikaans Tag = Tag{language: afIndex, locale: afIndex} + Amharic Tag = Tag{language: amIndex, locale: amIndex} + Arabic Tag = Tag{language: arIndex, locale: arIndex} + ModernStandardArabic Tag = Tag{language: ar001Index, locale: ar001Index} + Azerbaijani Tag = Tag{language: azIndex, locale: azIndex} + Bulgarian Tag = Tag{language: bgIndex, locale: bgIndex} + Bengali Tag = Tag{language: bnIndex, locale: bnIndex} + Catalan Tag = Tag{language: caIndex, locale: caIndex} + Czech Tag = Tag{language: csIndex, locale: csIndex} + Danish Tag = Tag{language: daIndex, locale: daIndex} + German Tag = Tag{language: deIndex, locale: deIndex} + Greek Tag = Tag{language: elIndex, locale: elIndex} + English Tag = Tag{language: enIndex, locale: enIndex} + AmericanEnglish Tag = Tag{language: enUSIndex, locale: enUSIndex} + BritishEnglish Tag = Tag{language: enGBIndex, locale: enGBIndex} + Spanish Tag = Tag{language: esIndex, locale: esIndex} + EuropeanSpanish Tag = Tag{language: esESIndex, locale: esESIndex} + LatinAmericanSpanish Tag = Tag{language: es419Index, locale: es419Index} + Estonian Tag = Tag{language: etIndex, locale: etIndex} + Persian Tag = Tag{language: faIndex, locale: faIndex} + Finnish Tag = Tag{language: fiIndex, locale: fiIndex} + Filipino Tag = Tag{language: filIndex, locale: filIndex} + French Tag = Tag{language: frIndex, locale: frIndex} + CanadianFrench Tag = Tag{language: frCAIndex, locale: frCAIndex} + Gujarati Tag = Tag{language: guIndex, locale: guIndex} + Hebrew Tag = Tag{language: heIndex, locale: heIndex} + Hindi Tag = Tag{language: hiIndex, locale: hiIndex} + Croatian Tag = Tag{language: hrIndex, locale: hrIndex} + Hungarian Tag = Tag{language: huIndex, locale: huIndex} + Armenian Tag = Tag{language: hyIndex, locale: hyIndex} + Indonesian Tag = Tag{language: idIndex, locale: idIndex} + Icelandic Tag = Tag{language: isIndex, locale: isIndex} + Italian Tag = Tag{language: itIndex, locale: itIndex} + Japanese Tag = Tag{language: jaIndex, locale: jaIndex} + Georgian Tag = Tag{language: kaIndex, locale: kaIndex} + Kazakh Tag = Tag{language: kkIndex, locale: kkIndex} + Khmer Tag = Tag{language: kmIndex, locale: kmIndex} + Kannada Tag = Tag{language: knIndex, locale: knIndex} + Korean Tag = Tag{language: koIndex, locale: koIndex} + Kirghiz Tag = Tag{language: kyIndex, locale: kyIndex} + Lao Tag = Tag{language: loIndex, locale: loIndex} + Lithuanian Tag = Tag{language: ltIndex, locale: ltIndex} + Latvian Tag = Tag{language: lvIndex, locale: lvIndex} + Macedonian Tag = Tag{language: mkIndex, locale: mkIndex} + Malayalam Tag = Tag{language: mlIndex, locale: mlIndex} + Mongolian Tag = Tag{language: mnIndex, locale: mnIndex} + Marathi Tag = Tag{language: mrIndex, locale: mrIndex} + Malay Tag = Tag{language: msIndex, locale: msIndex} + Burmese Tag = Tag{language: myIndex, locale: myIndex} + Nepali Tag = Tag{language: neIndex, locale: neIndex} + Dutch Tag = Tag{language: nlIndex, locale: nlIndex} + Norwegian Tag = Tag{language: noIndex, locale: noIndex} + Punjabi Tag = Tag{language: paIndex, locale: paIndex} + Polish Tag = Tag{language: plIndex, locale: plIndex} + Portuguese Tag = Tag{language: ptIndex, locale: ptIndex} + BrazilianPortuguese Tag = Tag{language: ptBRIndex, locale: ptBRIndex} + EuropeanPortuguese Tag = Tag{language: ptPTIndex, locale: ptPTIndex} + Romanian Tag = Tag{language: roIndex, locale: roIndex} + Russian Tag = Tag{language: ruIndex, locale: ruIndex} + Sinhala Tag = Tag{language: siIndex, locale: siIndex} + Slovak Tag = Tag{language: skIndex, locale: skIndex} + Slovenian Tag = Tag{language: slIndex, locale: slIndex} + Albanian Tag = Tag{language: sqIndex, locale: sqIndex} + Serbian Tag = Tag{language: srIndex, locale: srIndex} + SerbianLatin Tag = Tag{language: srLatnIndex, locale: srLatnIndex} + Swedish Tag = Tag{language: svIndex, locale: svIndex} + Swahili Tag = Tag{language: swIndex, locale: swIndex} + Tamil Tag = Tag{language: taIndex, locale: taIndex} + Telugu Tag = Tag{language: teIndex, locale: teIndex} + Thai Tag = Tag{language: thIndex, locale: thIndex} + Turkish Tag = Tag{language: trIndex, locale: trIndex} + Ukrainian Tag = Tag{language: ukIndex, locale: ukIndex} + Urdu Tag = Tag{language: urIndex, locale: urIndex} + Uzbek Tag = Tag{language: uzIndex, locale: uzIndex} + Vietnamese Tag = Tag{language: viIndex, locale: viIndex} + Chinese Tag = Tag{language: zhIndex, locale: zhIndex} + SimplifiedChinese Tag = Tag{language: zhHansIndex, locale: zhHansIndex} + TraditionalChinese Tag = Tag{language: zhHantIndex, locale: zhHantIndex} + Zulu Tag = Tag{language: zuIndex, locale: zuIndex} +) diff --git a/vendor/golang.org/x/text/internal/language/compose.go b/vendor/golang.org/x/text/internal/language/compose.go new file mode 100644 index 0000000..4ae78e0 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compose.go @@ -0,0 +1,167 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "sort" + "strings" +) + +// A Builder allows constructing a Tag from individual components. +// Its main user is Compose in the top-level language package. +type Builder struct { + Tag Tag + + private string // the x extension + variants []string + extensions []string +} + +// Make returns a new Tag from the current settings. +func (b *Builder) Make() Tag { + t := b.Tag + + if len(b.extensions) > 0 || len(b.variants) > 0 { + sort.Sort(sortVariants(b.variants)) + sort.Strings(b.extensions) + + if b.private != "" { + b.extensions = append(b.extensions, b.private) + } + n := maxCoreSize + tokenLen(b.variants...) + tokenLen(b.extensions...) + buf := make([]byte, n) + p := t.genCoreBytes(buf) + t.pVariant = byte(p) + p += appendTokens(buf[p:], b.variants...) + t.pExt = uint16(p) + p += appendTokens(buf[p:], b.extensions...) + t.str = string(buf[:p]) + // We may not always need to remake the string, but when or when not + // to do so is rather tricky. + scan := makeScanner(buf[:p]) + t, _ = parse(&scan, "") + return t + + } else if b.private != "" { + t.str = b.private + t.RemakeString() + } + return t +} + +// SetTag copies all the settings from a given Tag. Any previously set values +// are discarded. +func (b *Builder) SetTag(t Tag) { + b.Tag.LangID = t.LangID + b.Tag.RegionID = t.RegionID + b.Tag.ScriptID = t.ScriptID + // TODO: optimize + b.variants = b.variants[:0] + if variants := t.Variants(); variants != "" { + for _, vr := range strings.Split(variants[1:], "-") { + b.variants = append(b.variants, vr) + } + } + b.extensions, b.private = b.extensions[:0], "" + for _, e := range t.Extensions() { + b.AddExt(e) + } +} + +// AddExt adds extension e to the tag. e must be a valid extension as returned +// by Tag.Extension. If the extension already exists, it will be discarded, +// except for a -u extension, where non-existing key-type pairs will added. +func (b *Builder) AddExt(e string) { + if e[0] == 'x' { + if b.private == "" { + b.private = e + } + return + } + for i, s := range b.extensions { + if s[0] == e[0] { + if e[0] == 'u' { + b.extensions[i] += e[1:] + } + return + } + } + b.extensions = append(b.extensions, e) +} + +// SetExt sets the extension e to the tag. e must be a valid extension as +// returned by Tag.Extension. If the extension already exists, it will be +// overwritten, except for a -u extension, where the individual key-type pairs +// will be set. +func (b *Builder) SetExt(e string) { + if e[0] == 'x' { + b.private = e + return + } + for i, s := range b.extensions { + if s[0] == e[0] { + if e[0] == 'u' { + b.extensions[i] = e + s[1:] + } else { + b.extensions[i] = e + } + return + } + } + b.extensions = append(b.extensions, e) +} + +// AddVariant adds any number of variants. +func (b *Builder) AddVariant(v ...string) { + for _, v := range v { + if v != "" { + b.variants = append(b.variants, v) + } + } +} + +// ClearVariants removes any variants previously added, including those +// copied from a Tag in SetTag. +func (b *Builder) ClearVariants() { + b.variants = b.variants[:0] +} + +// ClearExtensions removes any extensions previously added, including those +// copied from a Tag in SetTag. +func (b *Builder) ClearExtensions() { + b.private = "" + b.extensions = b.extensions[:0] +} + +func tokenLen(token ...string) (n int) { + for _, t := range token { + n += len(t) + 1 + } + return +} + +func appendTokens(b []byte, token ...string) int { + p := 0 + for _, t := range token { + b[p] = '-' + copy(b[p+1:], t) + p += 1 + len(t) + } + return p +} + +type sortVariants []string + +func (s sortVariants) Len() int { + return len(s) +} + +func (s sortVariants) Swap(i, j int) { + s[j], s[i] = s[i], s[j] +} + +func (s sortVariants) Less(i, j int) bool { + return variantIndex[s[i]] < variantIndex[s[j]] +} diff --git a/vendor/golang.org/x/text/internal/language/coverage.go b/vendor/golang.org/x/text/internal/language/coverage.go new file mode 100644 index 0000000..9b20b88 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/coverage.go @@ -0,0 +1,28 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// BaseLanguages returns the list of all supported base languages. It generates +// the list by traversing the internal structures. +func BaseLanguages() []Language { + base := make([]Language, 0, NumLanguages) + for i := 0; i < langNoIndexOffset; i++ { + // We included "und" already for the value 0. + if i != nonCanonicalUnd { + base = append(base, Language(i)) + } + } + i := langNoIndexOffset + for _, v := range langNoIndex { + for k := 0; k < 8; k++ { + if v&1 == 1 { + base = append(base, Language(i)) + } + v >>= 1 + i++ + } + } + return base +} diff --git a/vendor/golang.org/x/text/internal/language/language.go b/vendor/golang.org/x/text/internal/language/language.go new file mode 100644 index 0000000..09d41c7 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/language.go @@ -0,0 +1,627 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_common.go -output tables.go + +package language // import "golang.org/x/text/internal/language" + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "errors" + "fmt" + "strings" +) + +const ( + // maxCoreSize is the maximum size of a BCP 47 tag without variants and + // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes. + maxCoreSize = 12 + + // max99thPercentileSize is a somewhat arbitrary buffer size that presumably + // is large enough to hold at least 99% of the BCP 47 tags. + max99thPercentileSize = 32 + + // maxSimpleUExtensionSize is the maximum size of a -u extension with one + // key-type pair. Equals len("-u-") + key (2) + dash + max value (8). + maxSimpleUExtensionSize = 14 +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. The zero value of Tag is Und. +type Tag struct { + // TODO: the following fields have the form TagTypeID. This name is chosen + // to allow refactoring the public package without conflicting with its + // Base, Script, and Region methods. Once the transition is fully completed + // the ID can be stripped from the name. + + LangID Language + RegionID Region + // TODO: we will soon run out of positions for ScriptID. Idea: instead of + // storing lang, region, and ScriptID codes, store only the compact index and + // have a lookup table from this code to its expansion. This greatly speeds + // up table lookup, speed up common variant cases. + // This will also immediately free up 3 extra bytes. Also, the pVariant + // field can now be moved to the lookup table, as the compact index uniquely + // determines the offset of a possible variant. + ScriptID Script + pVariant byte // offset in str, includes preceding '-' + pExt uint16 // offset of first extension, includes preceding '-' + + // str is the string representation of the Tag. It will only be used if the + // tag has variants or extensions. + str string +} + +// Make is a convenience wrapper for Parse that omits the error. +// In case of an error, a sensible default is returned. +func Make(s string) Tag { + t, _ := Parse(s) + return t +} + +// Raw returns the raw base language, script and region, without making an +// attempt to infer their values. +// TODO: consider removing +func (t Tag) Raw() (b Language, s Script, r Region) { + return t.LangID, t.ScriptID, t.RegionID +} + +// equalTags compares language, script and region subtags only. +func (t Tag) equalTags(a Tag) bool { + return t.LangID == a.LangID && t.ScriptID == a.ScriptID && t.RegionID == a.RegionID +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + if int(t.pVariant) < len(t.str) { + return false + } + return t.equalTags(Und) +} + +// IsPrivateUse reports whether the Tag consists solely of an IsPrivateUse use +// tag. +func (t Tag) IsPrivateUse() bool { + return t.str != "" && t.pVariant == 0 +} + +// RemakeString is used to update t.str in case lang, script or region changed. +// It is assumed that pExt and pVariant still point to the start of the +// respective parts. +func (t *Tag) RemakeString() { + if t.str == "" { + return + } + extra := t.str[t.pVariant:] + if t.pVariant > 0 { + extra = extra[1:] + } + if t.equalTags(Und) && strings.HasPrefix(extra, "x-") { + t.str = extra + t.pVariant = 0 + t.pExt = 0 + return + } + var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases. + b := buf[:t.genCoreBytes(buf[:])] + if extra != "" { + diff := len(b) - int(t.pVariant) + b = append(b, '-') + b = append(b, extra...) + t.pVariant = uint8(int(t.pVariant) + diff) + t.pExt = uint16(int(t.pExt) + diff) + } else { + t.pVariant = uint8(len(b)) + t.pExt = uint16(len(b)) + } + t.str = string(b) +} + +// genCoreBytes writes a string for the base languages, script and region tags +// to the given buffer and returns the number of bytes written. It will never +// write more than maxCoreSize bytes. +func (t *Tag) genCoreBytes(buf []byte) int { + n := t.LangID.StringToBuf(buf[:]) + if t.ScriptID != 0 { + n += copy(buf[n:], "-") + n += copy(buf[n:], t.ScriptID.String()) + } + if t.RegionID != 0 { + n += copy(buf[n:], "-") + n += copy(buf[n:], t.RegionID.String()) + } + return n +} + +// String returns the canonical string representation of the language tag. +func (t Tag) String() string { + if t.str != "" { + return t.str + } + if t.ScriptID == 0 && t.RegionID == 0 { + return t.LangID.String() + } + buf := [maxCoreSize]byte{} + return string(buf[:t.genCoreBytes(buf[:])]) +} + +// MarshalText implements encoding.TextMarshaler. +func (t Tag) MarshalText() (text []byte, err error) { + if t.str != "" { + text = append(text, t.str...) + } else if t.ScriptID == 0 && t.RegionID == 0 { + text = append(text, t.LangID.String()...) + } else { + buf := [maxCoreSize]byte{} + text = buf[:t.genCoreBytes(buf[:])] + } + return text, nil +} + +// UnmarshalText implements encoding.TextUnmarshaler. +func (t *Tag) UnmarshalText(text []byte) error { + tag, err := Parse(string(text)) + *t = tag + return err +} + +// Variants returns the part of the tag holding all variants or the empty string +// if there are no variants defined. +func (t Tag) Variants() string { + if t.pVariant == 0 { + return "" + } + return t.str[t.pVariant:t.pExt] +} + +// VariantOrPrivateUseTags returns variants or private use tags. +func (t Tag) VariantOrPrivateUseTags() string { + if t.pExt > 0 { + return t.str[t.pVariant:t.pExt] + } + return t.str[t.pVariant:] +} + +// HasString reports whether this tag defines more than just the raw +// components. +func (t Tag) HasString() bool { + return t.str != "" +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +func (t Tag) Parent() Tag { + if t.str != "" { + // Strip the variants and extensions. + b, s, r := t.Raw() + t = Tag{LangID: b, ScriptID: s, RegionID: r} + if t.RegionID == 0 && t.ScriptID != 0 && t.LangID != 0 { + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID == t.ScriptID { + return Tag{LangID: t.LangID} + } + } + return t + } + if t.LangID != 0 { + if t.RegionID != 0 { + maxScript := t.ScriptID + if maxScript == 0 { + max, _ := addTags(t) + maxScript = max.ScriptID + } + + for i := range parents { + if Language(parents[i].lang) == t.LangID && Script(parents[i].maxScript) == maxScript { + for _, r := range parents[i].fromRegion { + if Region(r) == t.RegionID { + return Tag{ + LangID: t.LangID, + ScriptID: Script(parents[i].script), + RegionID: Region(parents[i].toRegion), + } + } + } + } + } + + // Strip the script if it is the default one. + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID != maxScript { + return Tag{LangID: t.LangID, ScriptID: maxScript} + } + return Tag{LangID: t.LangID} + } else if t.ScriptID != 0 { + // The parent for an base-script pair with a non-default script is + // "und" instead of the base language. + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID != t.ScriptID { + return Und + } + return Tag{LangID: t.LangID} + } + } + return Und +} + +// ParseExtension parses s as an extension and returns it on success. +func ParseExtension(s string) (ext string, err error) { + defer func() { + if recover() != nil { + ext = "" + err = ErrSyntax + } + }() + + scan := makeScannerString(s) + var end int + if n := len(scan.token); n != 1 { + return "", ErrSyntax + } + scan.toLower(0, len(scan.b)) + end = parseExtension(&scan) + if end != len(s) { + return "", ErrSyntax + } + return string(scan.b), nil +} + +// HasVariants reports whether t has variants. +func (t Tag) HasVariants() bool { + return uint16(t.pVariant) < t.pExt +} + +// HasExtensions reports whether t has extensions. +func (t Tag) HasExtensions() bool { + return int(t.pExt) < len(t.str) +} + +// Extension returns the extension of type x for tag t. It will return +// false for ok if t does not have the requested extension. The returned +// extension will be invalid in this case. +func (t Tag) Extension(x byte) (ext string, ok bool) { + for i := int(t.pExt); i < len(t.str)-1; { + var ext string + i, ext = getExtension(t.str, i) + if ext[0] == x { + return ext, true + } + } + return "", false +} + +// Extensions returns all extensions of t. +func (t Tag) Extensions() []string { + e := []string{} + for i := int(t.pExt); i < len(t.str)-1; { + var ext string + i, ext = getExtension(t.str, i) + e = append(e, ext) + } + return e +} + +// TypeForKey returns the type associated with the given key, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// TypeForKey will traverse the inheritance chain to get the correct value. +// +// If there are multiple types associated with a key, only the first will be +// returned. If there is no type associated with a key, it returns the empty +// string. +func (t Tag) TypeForKey(key string) string { + if _, start, end, _ := t.findTypeForKey(key); end != start { + s := t.str[start:end] + if p := strings.IndexByte(s, '-'); p >= 0 { + s = s[:p] + } + return s + } + return "" +} + +var ( + errPrivateUse = errors.New("cannot set a key on a private use tag") + errInvalidArguments = errors.New("invalid key or type") +) + +// SetTypeForKey returns a new Tag with the key set to type, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// An empty value removes an existing pair with the same key. +func (t Tag) SetTypeForKey(key, value string) (Tag, error) { + if t.IsPrivateUse() { + return t, errPrivateUse + } + if len(key) != 2 { + return t, errInvalidArguments + } + + // Remove the setting if value is "". + if value == "" { + start, sep, end, _ := t.findTypeForKey(key) + if start != sep { + // Remove a possible empty extension. + switch { + case t.str[start-2] != '-': // has previous elements. + case end == len(t.str), // end of string + end+2 < len(t.str) && t.str[end+2] == '-': // end of extension + start -= 2 + } + if start == int(t.pVariant) && end == len(t.str) { + t.str = "" + t.pVariant, t.pExt = 0, 0 + } else { + t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:]) + } + } + return t, nil + } + + if len(value) < 3 || len(value) > 8 { + return t, errInvalidArguments + } + + var ( + buf [maxCoreSize + maxSimpleUExtensionSize]byte + uStart int // start of the -u extension. + ) + + // Generate the tag string if needed. + if t.str == "" { + uStart = t.genCoreBytes(buf[:]) + buf[uStart] = '-' + uStart++ + } + + // Create new key-type pair and parse it to verify. + b := buf[uStart:] + copy(b, "u-") + copy(b[2:], key) + b[4] = '-' + b = b[:5+copy(b[5:], value)] + scan := makeScanner(b) + if parseExtensions(&scan); scan.err != nil { + return t, scan.err + } + + // Assemble the replacement string. + if t.str == "" { + t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1) + t.str = string(buf[:uStart+len(b)]) + } else { + s := t.str + start, sep, end, hasExt := t.findTypeForKey(key) + if start == sep { + if hasExt { + b = b[2:] + } + t.str = fmt.Sprintf("%s-%s%s", s[:sep], b, s[end:]) + } else { + t.str = fmt.Sprintf("%s-%s%s", s[:start+3], value, s[end:]) + } + } + return t, nil +} + +// findTypeForKey returns the start and end position for the type corresponding +// to key or the point at which to insert the key-value pair if the type +// wasn't found. The hasExt return value reports whether an -u extension was present. +// Note: the extensions are typically very small and are likely to contain +// only one key-type pair. +func (t Tag) findTypeForKey(key string) (start, sep, end int, hasExt bool) { + p := int(t.pExt) + if len(key) != 2 || p == len(t.str) || p == 0 { + return p, p, p, false + } + s := t.str + + // Find the correct extension. + for p++; s[p] != 'u'; p++ { + if s[p] > 'u' { + p-- + return p, p, p, false + } + if p = nextExtension(s, p); p == len(s) { + return len(s), len(s), len(s), false + } + } + // Proceed to the hyphen following the extension name. + p++ + + // curKey is the key currently being processed. + curKey := "" + + // Iterate over keys until we get the end of a section. + for { + end = p + for p++; p < len(s) && s[p] != '-'; p++ { + } + n := p - end - 1 + if n <= 2 && curKey == key { + if sep < end { + sep++ + } + return start, sep, end, true + } + switch n { + case 0, // invalid string + 1: // next extension + return end, end, end, true + case 2: + // next key + curKey = s[end+1 : p] + if curKey > key { + return end, end, end, true + } + start = end + sep = p + } + } +} + +// ParseBase parses a 2- or 3-letter ISO 639 code. +// It returns a ValueError if s is a well-formed but unknown language identifier +// or another error if another error occurred. +func ParseBase(s string) (l Language, err error) { + defer func() { + if recover() != nil { + l = 0 + err = ErrSyntax + } + }() + + if n := len(s); n < 2 || 3 < n { + return 0, ErrSyntax + } + var buf [3]byte + return getLangID(buf[:copy(buf[:], s)]) +} + +// ParseScript parses a 4-letter ISO 15924 code. +// It returns a ValueError if s is a well-formed but unknown script identifier +// or another error if another error occurred. +func ParseScript(s string) (scr Script, err error) { + defer func() { + if recover() != nil { + scr = 0 + err = ErrSyntax + } + }() + + if len(s) != 4 { + return 0, ErrSyntax + } + var buf [4]byte + return getScriptID(script, buf[:copy(buf[:], s)]) +} + +// EncodeM49 returns the Region for the given UN M.49 code. +// It returns an error if r is not a valid code. +func EncodeM49(r int) (Region, error) { + return getRegionM49(r) +} + +// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. +// It returns a ValueError if s is a well-formed but unknown region identifier +// or another error if another error occurred. +func ParseRegion(s string) (r Region, err error) { + defer func() { + if recover() != nil { + r = 0 + err = ErrSyntax + } + }() + + if n := len(s); n < 2 || 3 < n { + return 0, ErrSyntax + } + var buf [3]byte + return getRegionID(buf[:copy(buf[:], s)]) +} + +// IsCountry returns whether this region is a country or autonomous area. This +// includes non-standard definitions from CLDR. +func (r Region) IsCountry() bool { + if r == 0 || r.IsGroup() || r.IsPrivateUse() && r != _XK { + return false + } + return true +} + +// IsGroup returns whether this region defines a collection of regions. This +// includes non-standard definitions from CLDR. +func (r Region) IsGroup() bool { + if r == 0 { + return false + } + return int(regionInclusion[r]) < len(regionContainment) +} + +// Contains returns whether Region c is contained by Region r. It returns true +// if c == r. +func (r Region) Contains(c Region) bool { + if r == c { + return true + } + g := regionInclusion[r] + if g >= nRegionGroups { + return false + } + m := regionContainment[g] + + d := regionInclusion[c] + b := regionInclusionBits[d] + + // A contained country may belong to multiple disjoint groups. Matching any + // of these indicates containment. If the contained region is a group, it + // must strictly be a subset. + if d >= nRegionGroups { + return b&m != 0 + } + return b&^m == 0 +} + +var errNoTLD = errors.New("language: region is not a valid ccTLD") + +// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. +// In all other cases it returns either the region itself or an error. +// +// This method may return an error for a region for which there exists a +// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The +// region will already be canonicalized it was obtained from a Tag that was +// obtained using any of the default methods. +func (r Region) TLD() (Region, error) { + // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the + // difference between ISO 3166-1 and IANA ccTLD. + if r == _GB { + r = _UK + } + if (r.typ() & ccTLD) == 0 { + return 0, errNoTLD + } + return r, nil +} + +// Canonicalize returns the region or a possible replacement if the region is +// deprecated. It will not return a replacement for deprecated regions that +// are split into multiple regions. +func (r Region) Canonicalize() Region { + if cr := normRegion(r); cr != 0 { + return cr + } + return r +} + +// Variant represents a registered variant of a language as defined by BCP 47. +type Variant struct { + ID uint8 + str string +} + +// ParseVariant parses and returns a Variant. An error is returned if s is not +// a valid variant. +func ParseVariant(s string) (v Variant, err error) { + defer func() { + if recover() != nil { + v = Variant{} + err = ErrSyntax + } + }() + + s = strings.ToLower(s) + if id, ok := variantIndex[s]; ok { + return Variant{id, s}, nil + } + return Variant{}, NewValueError([]byte(s)) +} + +// String returns the string representation of the variant. +func (v Variant) String() string { + return v.str +} diff --git a/vendor/golang.org/x/text/internal/language/lookup.go b/vendor/golang.org/x/text/internal/language/lookup.go new file mode 100644 index 0000000..231b4fb --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/lookup.go @@ -0,0 +1,412 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "bytes" + "fmt" + "sort" + "strconv" + + "golang.org/x/text/internal/tag" +) + +// findIndex tries to find the given tag in idx and returns a standardized error +// if it could not be found. +func findIndex(idx tag.Index, key []byte, form string) (index int, err error) { + if !tag.FixCase(form, key) { + return 0, ErrSyntax + } + i := idx.Index(key) + if i == -1 { + return 0, NewValueError(key) + } + return i, nil +} + +func searchUint(imap []uint16, key uint16) int { + return sort.Search(len(imap), func(i int) bool { + return imap[i] >= key + }) +} + +type Language uint16 + +// getLangID returns the langID of s if s is a canonical subtag +// or langUnknown if s is not a canonical subtag. +func getLangID(s []byte) (Language, error) { + if len(s) == 2 { + return getLangISO2(s) + } + return getLangISO3(s) +} + +// TODO language normalization as well as the AliasMaps could be moved to the +// higher level package, but it is a bit tricky to separate the generation. + +func (id Language) Canonicalize() (Language, AliasType) { + return normLang(id) +} + +// normLang returns the mapped langID of id according to mapping m. +func normLang(id Language) (Language, AliasType) { + k := sort.Search(len(AliasMap), func(i int) bool { + return AliasMap[i].From >= uint16(id) + }) + if k < len(AliasMap) && AliasMap[k].From == uint16(id) { + return Language(AliasMap[k].To), AliasTypes[k] + } + return id, AliasTypeUnknown +} + +// getLangISO2 returns the langID for the given 2-letter ISO language code +// or unknownLang if this does not exist. +func getLangISO2(s []byte) (Language, error) { + if !tag.FixCase("zz", s) { + return 0, ErrSyntax + } + if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 { + return Language(i), nil + } + return 0, NewValueError(s) +} + +const base = 'z' - 'a' + 1 + +func strToInt(s []byte) uint { + v := uint(0) + for i := 0; i < len(s); i++ { + v *= base + v += uint(s[i] - 'a') + } + return v +} + +// converts the given integer to the original ASCII string passed to strToInt. +// len(s) must match the number of characters obtained. +func intToStr(v uint, s []byte) { + for i := len(s) - 1; i >= 0; i-- { + s[i] = byte(v%base) + 'a' + v /= base + } +} + +// getLangISO3 returns the langID for the given 3-letter ISO language code +// or unknownLang if this does not exist. +func getLangISO3(s []byte) (Language, error) { + if tag.FixCase("und", s) { + // first try to match canonical 3-letter entries + for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) { + if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] { + // We treat "und" as special and always translate it to "unspecified". + // Note that ZZ and Zzzz are private use and are not treated as + // unspecified by default. + id := Language(i) + if id == nonCanonicalUnd { + return 0, nil + } + return id, nil + } + } + if i := altLangISO3.Index(s); i != -1 { + return Language(altLangIndex[altLangISO3.Elem(i)[3]]), nil + } + n := strToInt(s) + if langNoIndex[n/8]&(1<<(n%8)) != 0 { + return Language(n) + langNoIndexOffset, nil + } + // Check for non-canonical uses of ISO3. + for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) { + if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] { + return Language(i), nil + } + } + return 0, NewValueError(s) + } + return 0, ErrSyntax +} + +// StringToBuf writes the string to b and returns the number of bytes +// written. cap(b) must be >= 3. +func (id Language) StringToBuf(b []byte) int { + if id >= langNoIndexOffset { + intToStr(uint(id)-langNoIndexOffset, b[:3]) + return 3 + } else if id == 0 { + return copy(b, "und") + } + l := lang[id<<2:] + if l[3] == 0 { + return copy(b, l[:3]) + } + return copy(b, l[:2]) +} + +// String returns the BCP 47 representation of the langID. +// Use b as variable name, instead of id, to ensure the variable +// used is consistent with that of Base in which this type is embedded. +func (b Language) String() string { + if b == 0 { + return "und" + } else if b >= langNoIndexOffset { + b -= langNoIndexOffset + buf := [3]byte{} + intToStr(uint(b), buf[:]) + return string(buf[:]) + } + l := lang.Elem(int(b)) + if l[3] == 0 { + return l[:3] + } + return l[:2] +} + +// ISO3 returns the ISO 639-3 language code. +func (b Language) ISO3() string { + if b == 0 || b >= langNoIndexOffset { + return b.String() + } + l := lang.Elem(int(b)) + if l[3] == 0 { + return l[:3] + } else if l[2] == 0 { + return altLangISO3.Elem(int(l[3]))[:3] + } + // This allocation will only happen for 3-letter ISO codes + // that are non-canonical BCP 47 language identifiers. + return l[0:1] + l[2:4] +} + +// IsPrivateUse reports whether this language code is reserved for private use. +func (b Language) IsPrivateUse() bool { + return langPrivateStart <= b && b <= langPrivateEnd +} + +// SuppressScript returns the script marked as SuppressScript in the IANA +// language tag repository, or 0 if there is no such script. +func (b Language) SuppressScript() Script { + if b < langNoIndexOffset { + return Script(suppressScript[b]) + } + return 0 +} + +type Region uint16 + +// getRegionID returns the region id for s if s is a valid 2-letter region code +// or unknownRegion. +func getRegionID(s []byte) (Region, error) { + if len(s) == 3 { + if isAlpha(s[0]) { + return getRegionISO3(s) + } + if i, err := strconv.ParseUint(string(s), 10, 10); err == nil { + return getRegionM49(int(i)) + } + } + return getRegionISO2(s) +} + +// getRegionISO2 returns the regionID for the given 2-letter ISO country code +// or unknownRegion if this does not exist. +func getRegionISO2(s []byte) (Region, error) { + i, err := findIndex(regionISO, s, "ZZ") + if err != nil { + return 0, err + } + return Region(i) + isoRegionOffset, nil +} + +// getRegionISO3 returns the regionID for the given 3-letter ISO country code +// or unknownRegion if this does not exist. +func getRegionISO3(s []byte) (Region, error) { + if tag.FixCase("ZZZ", s) { + for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) { + if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] { + return Region(i) + isoRegionOffset, nil + } + } + for i := 0; i < len(altRegionISO3); i += 3 { + if tag.Compare(altRegionISO3[i:i+3], s) == 0 { + return Region(altRegionIDs[i/3]), nil + } + } + return 0, NewValueError(s) + } + return 0, ErrSyntax +} + +func getRegionM49(n int) (Region, error) { + if 0 < n && n <= 999 { + const ( + searchBits = 7 + regionBits = 9 + regionMask = 1<> searchBits + buf := fromM49[m49Index[idx]:m49Index[idx+1]] + val := uint16(n) << regionBits // we rely on bits shifting out + i := sort.Search(len(buf), func(i int) bool { + return buf[i] >= val + }) + if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val { + return Region(r & regionMask), nil + } + } + var e ValueError + fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n) + return 0, e +} + +// normRegion returns a region if r is deprecated or 0 otherwise. +// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ). +// TODO: consider mapping split up regions to new most populous one (like CLDR). +func normRegion(r Region) Region { + m := regionOldMap + k := sort.Search(len(m), func(i int) bool { + return m[i].From >= uint16(r) + }) + if k < len(m) && m[k].From == uint16(r) { + return Region(m[k].To) + } + return 0 +} + +const ( + iso3166UserAssigned = 1 << iota + ccTLD + bcp47Region +) + +func (r Region) typ() byte { + return regionTypes[r] +} + +// String returns the BCP 47 representation for the region. +// It returns "ZZ" for an unspecified region. +func (r Region) String() string { + if r < isoRegionOffset { + if r == 0 { + return "ZZ" + } + return fmt.Sprintf("%03d", r.M49()) + } + r -= isoRegionOffset + return regionISO.Elem(int(r))[:2] +} + +// ISO3 returns the 3-letter ISO code of r. +// Note that not all regions have a 3-letter ISO code. +// In such cases this method returns "ZZZ". +func (r Region) ISO3() string { + if r < isoRegionOffset { + return "ZZZ" + } + r -= isoRegionOffset + reg := regionISO.Elem(int(r)) + switch reg[2] { + case 0: + return altRegionISO3[reg[3]:][:3] + case ' ': + return "ZZZ" + } + return reg[0:1] + reg[2:4] +} + +// M49 returns the UN M.49 encoding of r, or 0 if this encoding +// is not defined for r. +func (r Region) M49() int { + return int(m49[r]) +} + +// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This +// may include private-use tags that are assigned by CLDR and used in this +// implementation. So IsPrivateUse and IsCountry can be simultaneously true. +func (r Region) IsPrivateUse() bool { + return r.typ()&iso3166UserAssigned != 0 +} + +type Script uint16 + +// getScriptID returns the script id for string s. It assumes that s +// is of the format [A-Z][a-z]{3}. +func getScriptID(idx tag.Index, s []byte) (Script, error) { + i, err := findIndex(idx, s, "Zzzz") + return Script(i), err +} + +// String returns the script code in title case. +// It returns "Zzzz" for an unspecified script. +func (s Script) String() string { + if s == 0 { + return "Zzzz" + } + return script.Elem(int(s)) +} + +// IsPrivateUse reports whether this script code is reserved for private use. +func (s Script) IsPrivateUse() bool { + return _Qaaa <= s && s <= _Qabx +} + +const ( + maxAltTaglen = len("en-US-POSIX") + maxLen = maxAltTaglen +) + +var ( + // grandfatheredMap holds a mapping from legacy and grandfathered tags to + // their base language or index to more elaborate tag. + grandfatheredMap = map[[maxLen]byte]int16{ + [maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban + [maxLen]byte{'i', '-', 'a', 'm', 'i'}: _ami, // i-ami + [maxLen]byte{'i', '-', 'b', 'n', 'n'}: _bnn, // i-bnn + [maxLen]byte{'i', '-', 'h', 'a', 'k'}: _hak, // i-hak + [maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}: _tlh, // i-klingon + [maxLen]byte{'i', '-', 'l', 'u', 'x'}: _lb, // i-lux + [maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}: _nv, // i-navajo + [maxLen]byte{'i', '-', 'p', 'w', 'n'}: _pwn, // i-pwn + [maxLen]byte{'i', '-', 't', 'a', 'o'}: _tao, // i-tao + [maxLen]byte{'i', '-', 't', 'a', 'y'}: _tay, // i-tay + [maxLen]byte{'i', '-', 't', 's', 'u'}: _tsu, // i-tsu + [maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}: _nb, // no-bok + [maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}: _nn, // no-nyn + [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}: _sfb, // sgn-BE-FR + [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}: _vgt, // sgn-BE-NL + [maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}: _sgg, // sgn-CH-DE + [maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}: _cmn, // zh-guoyu + [maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}: _hak, // zh-hakka + [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan + [maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}: _hsn, // zh-xiang + + // Grandfathered tags with no modern replacement will be converted as + // follows: + [maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish + [maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}: -2, // en-GB-oed + [maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}: -3, // i-default + [maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}: -4, // i-enochian + [maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}: -5, // i-mingo + [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}: -6, // zh-min + + // CLDR-specific tag. + [maxLen]byte{'r', 'o', 'o', 't'}: 0, // root + [maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX" + } + + altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102} + + altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix" +) + +func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) { + if v, ok := grandfatheredMap[s]; ok { + if v < 0 { + return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true + } + t.LangID = Language(v) + return t, true + } + return t, false +} diff --git a/vendor/golang.org/x/text/internal/language/match.go b/vendor/golang.org/x/text/internal/language/match.go new file mode 100644 index 0000000..75a2dbc --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/match.go @@ -0,0 +1,226 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import "errors" + +type scriptRegionFlags uint8 + +const ( + isList = 1 << iota + scriptInFrom + regionInFrom +) + +func (t *Tag) setUndefinedLang(id Language) { + if t.LangID == 0 { + t.LangID = id + } +} + +func (t *Tag) setUndefinedScript(id Script) { + if t.ScriptID == 0 { + t.ScriptID = id + } +} + +func (t *Tag) setUndefinedRegion(id Region) { + if t.RegionID == 0 || t.RegionID.Contains(id) { + t.RegionID = id + } +} + +// ErrMissingLikelyTagsData indicates no information was available +// to compute likely values of missing tags. +var ErrMissingLikelyTagsData = errors.New("missing likely tags data") + +// addLikelySubtags sets subtags to their most likely value, given the locale. +// In most cases this means setting fields for unknown values, but in some +// cases it may alter a value. It returns an ErrMissingLikelyTagsData error +// if the given locale cannot be expanded. +func (t Tag) addLikelySubtags() (Tag, error) { + id, err := addTags(t) + if err != nil { + return t, err + } else if id.equalTags(t) { + return t, nil + } + id.RemakeString() + return id, nil +} + +// specializeRegion attempts to specialize a group region. +func specializeRegion(t *Tag) bool { + if i := regionInclusion[t.RegionID]; i < nRegionGroups { + x := likelyRegionGroup[i] + if Language(x.lang) == t.LangID && Script(x.script) == t.ScriptID { + t.RegionID = Region(x.region) + } + return true + } + return false +} + +// Maximize returns a new tag with missing tags filled in. +func (t Tag) Maximize() (Tag, error) { + return addTags(t) +} + +func addTags(t Tag) (Tag, error) { + // We leave private use identifiers alone. + if t.IsPrivateUse() { + return t, nil + } + if t.ScriptID != 0 && t.RegionID != 0 { + if t.LangID != 0 { + // already fully specified + specializeRegion(&t) + return t, nil + } + // Search matches for und-script-region. Note that for these cases + // region will never be a group so there is no need to check for this. + list := likelyRegion[t.RegionID : t.RegionID+1] + if x := list[0]; x.flags&isList != 0 { + list = likelyRegionList[x.lang : x.lang+uint16(x.script)] + } + for _, x := range list { + // Deviating from the spec. See match_test.go for details. + if Script(x.script) == t.ScriptID { + t.setUndefinedLang(Language(x.lang)) + return t, nil + } + } + } + if t.LangID != 0 { + // Search matches for lang-script and lang-region, where lang != und. + if t.LangID < langNoIndexOffset { + x := likelyLang[t.LangID] + if x.flags&isList != 0 { + list := likelyLangList[x.region : x.region+uint16(x.script)] + if t.ScriptID != 0 { + for _, x := range list { + if Script(x.script) == t.ScriptID && x.flags&scriptInFrom != 0 { + t.setUndefinedRegion(Region(x.region)) + return t, nil + } + } + } else if t.RegionID != 0 { + count := 0 + goodScript := true + tt := t + for _, x := range list { + // We visit all entries for which the script was not + // defined, including the ones where the region was not + // defined. This allows for proper disambiguation within + // regions. + if x.flags&scriptInFrom == 0 && t.RegionID.Contains(Region(x.region)) { + tt.RegionID = Region(x.region) + tt.setUndefinedScript(Script(x.script)) + goodScript = goodScript && tt.ScriptID == Script(x.script) + count++ + } + } + if count == 1 { + return tt, nil + } + // Even if we fail to find a unique Region, we might have + // an unambiguous script. + if goodScript { + t.ScriptID = tt.ScriptID + } + } + } + } + } else { + // Search matches for und-script. + if t.ScriptID != 0 { + x := likelyScript[t.ScriptID] + if x.region != 0 { + t.setUndefinedRegion(Region(x.region)) + t.setUndefinedLang(Language(x.lang)) + return t, nil + } + } + // Search matches for und-region. If und-script-region exists, it would + // have been found earlier. + if t.RegionID != 0 { + if i := regionInclusion[t.RegionID]; i < nRegionGroups { + x := likelyRegionGroup[i] + if x.region != 0 { + t.setUndefinedLang(Language(x.lang)) + t.setUndefinedScript(Script(x.script)) + t.RegionID = Region(x.region) + } + } else { + x := likelyRegion[t.RegionID] + if x.flags&isList != 0 { + x = likelyRegionList[x.lang] + } + if x.script != 0 && x.flags != scriptInFrom { + t.setUndefinedLang(Language(x.lang)) + t.setUndefinedScript(Script(x.script)) + return t, nil + } + } + } + } + + // Search matches for lang. + if t.LangID < langNoIndexOffset { + x := likelyLang[t.LangID] + if x.flags&isList != 0 { + x = likelyLangList[x.region] + } + if x.region != 0 { + t.setUndefinedScript(Script(x.script)) + t.setUndefinedRegion(Region(x.region)) + } + specializeRegion(&t) + if t.LangID == 0 { + t.LangID = _en // default language + } + return t, nil + } + return t, ErrMissingLikelyTagsData +} + +func (t *Tag) setTagsFrom(id Tag) { + t.LangID = id.LangID + t.ScriptID = id.ScriptID + t.RegionID = id.RegionID +} + +// minimize removes the region or script subtags from t such that +// t.addLikelySubtags() == t.minimize().addLikelySubtags(). +func (t Tag) minimize() (Tag, error) { + t, err := minimizeTags(t) + if err != nil { + return t, err + } + t.RemakeString() + return t, nil +} + +// minimizeTags mimics the behavior of the ICU 51 C implementation. +func minimizeTags(t Tag) (Tag, error) { + if t.equalTags(Und) { + return t, nil + } + max, err := addTags(t) + if err != nil { + return t, err + } + for _, id := range [...]Tag{ + {LangID: t.LangID}, + {LangID: t.LangID, RegionID: t.RegionID}, + {LangID: t.LangID, ScriptID: t.ScriptID}, + } { + if x, err := addTags(id); err == nil && max.equalTags(x) { + t.setTagsFrom(id) + break + } + } + return t, nil +} diff --git a/vendor/golang.org/x/text/internal/language/parse.go b/vendor/golang.org/x/text/internal/language/parse.go new file mode 100644 index 0000000..aad1e0a --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/parse.go @@ -0,0 +1,608 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "bytes" + "errors" + "fmt" + "sort" + + "golang.org/x/text/internal/tag" +) + +// isAlpha returns true if the byte is not a digit. +// b must be an ASCII letter or digit. +func isAlpha(b byte) bool { + return b > '9' +} + +// isAlphaNum returns true if the string contains only ASCII letters or digits. +func isAlphaNum(s []byte) bool { + for _, c := range s { + if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') { + return false + } + } + return true +} + +// ErrSyntax is returned by any of the parsing functions when the +// input is not well-formed, according to BCP 47. +// TODO: return the position at which the syntax error occurred? +var ErrSyntax = errors.New("language: tag is not well-formed") + +// ErrDuplicateKey is returned when a tag contains the same key twice with +// different values in the -u section. +var ErrDuplicateKey = errors.New("language: different values for same key in -u extension") + +// ValueError is returned by any of the parsing functions when the +// input is well-formed but the respective subtag is not recognized +// as a valid value. +type ValueError struct { + v [8]byte +} + +// NewValueError creates a new ValueError. +func NewValueError(tag []byte) ValueError { + var e ValueError + copy(e.v[:], tag) + return e +} + +func (e ValueError) tag() []byte { + n := bytes.IndexByte(e.v[:], 0) + if n == -1 { + n = 8 + } + return e.v[:n] +} + +// Error implements the error interface. +func (e ValueError) Error() string { + return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag()) +} + +// Subtag returns the subtag for which the error occurred. +func (e ValueError) Subtag() string { + return string(e.tag()) +} + +// scanner is used to scan BCP 47 tokens, which are separated by _ or -. +type scanner struct { + b []byte + bytes [max99thPercentileSize]byte + token []byte + start int // start position of the current token + end int // end position of the current token + next int // next point for scan + err error + done bool +} + +func makeScannerString(s string) scanner { + scan := scanner{} + if len(s) <= len(scan.bytes) { + scan.b = scan.bytes[:copy(scan.bytes[:], s)] + } else { + scan.b = []byte(s) + } + scan.init() + return scan +} + +// makeScanner returns a scanner using b as the input buffer. +// b is not copied and may be modified by the scanner routines. +func makeScanner(b []byte) scanner { + scan := scanner{b: b} + scan.init() + return scan +} + +func (s *scanner) init() { + for i, c := range s.b { + if c == '_' { + s.b[i] = '-' + } + } + s.scan() +} + +// restToLower converts the string between start and end to lower case. +func (s *scanner) toLower(start, end int) { + for i := start; i < end; i++ { + c := s.b[i] + if 'A' <= c && c <= 'Z' { + s.b[i] += 'a' - 'A' + } + } +} + +func (s *scanner) setError(e error) { + if s.err == nil || (e == ErrSyntax && s.err != ErrSyntax) { + s.err = e + } +} + +// resizeRange shrinks or grows the array at position oldStart such that +// a new string of size newSize can fit between oldStart and oldEnd. +// Sets the scan point to after the resized range. +func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) { + s.start = oldStart + if end := oldStart + newSize; end != oldEnd { + diff := end - oldEnd + var b []byte + if n := len(s.b) + diff; n > cap(s.b) { + b = make([]byte, n) + copy(b, s.b[:oldStart]) + } else { + b = s.b[:n] + } + copy(b[end:], s.b[oldEnd:]) + s.b = b + s.next = end + (s.next - s.end) + s.end = end + } +} + +// replace replaces the current token with repl. +func (s *scanner) replace(repl string) { + s.resizeRange(s.start, s.end, len(repl)) + copy(s.b[s.start:], repl) +} + +// gobble removes the current token from the input. +// Caller must call scan after calling gobble. +func (s *scanner) gobble(e error) { + s.setError(e) + if s.start == 0 { + s.b = s.b[:+copy(s.b, s.b[s.next:])] + s.end = 0 + } else { + s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])] + s.end = s.start - 1 + } + s.next = s.start +} + +// deleteRange removes the given range from s.b before the current token. +func (s *scanner) deleteRange(start, end int) { + s.b = s.b[:start+copy(s.b[start:], s.b[end:])] + diff := end - start + s.next -= diff + s.start -= diff + s.end -= diff +} + +// scan parses the next token of a BCP 47 string. Tokens that are larger +// than 8 characters or include non-alphanumeric characters result in an error +// and are gobbled and removed from the output. +// It returns the end position of the last token consumed. +func (s *scanner) scan() (end int) { + end = s.end + s.token = nil + for s.start = s.next; s.next < len(s.b); { + i := bytes.IndexByte(s.b[s.next:], '-') + if i == -1 { + s.end = len(s.b) + s.next = len(s.b) + i = s.end - s.start + } else { + s.end = s.next + i + s.next = s.end + 1 + } + token := s.b[s.start:s.end] + if i < 1 || i > 8 || !isAlphaNum(token) { + s.gobble(ErrSyntax) + continue + } + s.token = token + return end + } + if n := len(s.b); n > 0 && s.b[n-1] == '-' { + s.setError(ErrSyntax) + s.b = s.b[:len(s.b)-1] + } + s.done = true + return end +} + +// acceptMinSize parses multiple tokens of the given size or greater. +// It returns the end position of the last token consumed. +func (s *scanner) acceptMinSize(min int) (end int) { + end = s.end + s.scan() + for ; len(s.token) >= min; s.scan() { + end = s.end + } + return end +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +func Parse(s string) (t Tag, err error) { + // TODO: consider supporting old-style locale key-value pairs. + if s == "" { + return Und, ErrSyntax + } + defer func() { + if recover() != nil { + t = Und + err = ErrSyntax + return + } + }() + if len(s) <= maxAltTaglen { + b := [maxAltTaglen]byte{} + for i, c := range s { + // Generating invalid UTF-8 is okay as it won't match. + if 'A' <= c && c <= 'Z' { + c += 'a' - 'A' + } else if c == '_' { + c = '-' + } + b[i] = byte(c) + } + if t, ok := grandfathered(b); ok { + return t, nil + } + } + scan := makeScannerString(s) + return parse(&scan, s) +} + +func parse(scan *scanner, s string) (t Tag, err error) { + t = Und + var end int + if n := len(scan.token); n <= 1 { + scan.toLower(0, len(scan.b)) + if n == 0 || scan.token[0] != 'x' { + return t, ErrSyntax + } + end = parseExtensions(scan) + } else if n >= 4 { + return Und, ErrSyntax + } else { // the usual case + t, end = parseTag(scan, true) + if n := len(scan.token); n == 1 { + t.pExt = uint16(end) + end = parseExtensions(scan) + } else if end < len(scan.b) { + scan.setError(ErrSyntax) + scan.b = scan.b[:end] + } + } + if int(t.pVariant) < len(scan.b) { + if end < len(s) { + s = s[:end] + } + if len(s) > 0 && tag.Compare(s, scan.b) == 0 { + t.str = s + } else { + t.str = string(scan.b) + } + } else { + t.pVariant, t.pExt = 0, 0 + } + return t, scan.err +} + +// parseTag parses language, script, region and variants. +// It returns a Tag and the end position in the input that was parsed. +// If doNorm is true, then - will be normalized to . +func parseTag(scan *scanner, doNorm bool) (t Tag, end int) { + var e error + // TODO: set an error if an unknown lang, script or region is encountered. + t.LangID, e = getLangID(scan.token) + scan.setError(e) + scan.replace(t.LangID.String()) + langStart := scan.start + end = scan.scan() + for len(scan.token) == 3 && isAlpha(scan.token[0]) { + // From http://tools.ietf.org/html/bcp47, - tags are equivalent + // to a tag of the form . + if doNorm { + lang, e := getLangID(scan.token) + if lang != 0 { + t.LangID = lang + langStr := lang.String() + copy(scan.b[langStart:], langStr) + scan.b[langStart+len(langStr)] = '-' + scan.start = langStart + len(langStr) + 1 + } + scan.gobble(e) + } + end = scan.scan() + } + if len(scan.token) == 4 && isAlpha(scan.token[0]) { + t.ScriptID, e = getScriptID(script, scan.token) + if t.ScriptID == 0 { + scan.gobble(e) + } + end = scan.scan() + } + if n := len(scan.token); n >= 2 && n <= 3 { + t.RegionID, e = getRegionID(scan.token) + if t.RegionID == 0 { + scan.gobble(e) + } else { + scan.replace(t.RegionID.String()) + } + end = scan.scan() + } + scan.toLower(scan.start, len(scan.b)) + t.pVariant = byte(end) + end = parseVariants(scan, end, t) + t.pExt = uint16(end) + return t, end +} + +var separator = []byte{'-'} + +// parseVariants scans tokens as long as each token is a valid variant string. +// Duplicate variants are removed. +func parseVariants(scan *scanner, end int, t Tag) int { + start := scan.start + varIDBuf := [4]uint8{} + variantBuf := [4][]byte{} + varID := varIDBuf[:0] + variant := variantBuf[:0] + last := -1 + needSort := false + for ; len(scan.token) >= 4; scan.scan() { + // TODO: measure the impact of needing this conversion and redesign + // the data structure if there is an issue. + v, ok := variantIndex[string(scan.token)] + if !ok { + // unknown variant + // TODO: allow user-defined variants? + scan.gobble(NewValueError(scan.token)) + continue + } + varID = append(varID, v) + variant = append(variant, scan.token) + if !needSort { + if last < int(v) { + last = int(v) + } else { + needSort = true + // There is no legal combinations of more than 7 variants + // (and this is by no means a useful sequence). + const maxVariants = 8 + if len(varID) > maxVariants { + break + } + } + } + end = scan.end + } + if needSort { + sort.Sort(variantsSort{varID, variant}) + k, l := 0, -1 + for i, v := range varID { + w := int(v) + if l == w { + // Remove duplicates. + continue + } + varID[k] = varID[i] + variant[k] = variant[i] + k++ + l = w + } + if str := bytes.Join(variant[:k], separator); len(str) == 0 { + end = start - 1 + } else { + scan.resizeRange(start, end, len(str)) + copy(scan.b[scan.start:], str) + end = scan.end + } + } + return end +} + +type variantsSort struct { + i []uint8 + v [][]byte +} + +func (s variantsSort) Len() int { + return len(s.i) +} + +func (s variantsSort) Swap(i, j int) { + s.i[i], s.i[j] = s.i[j], s.i[i] + s.v[i], s.v[j] = s.v[j], s.v[i] +} + +func (s variantsSort) Less(i, j int) bool { + return s.i[i] < s.i[j] +} + +type bytesSort struct { + b [][]byte + n int // first n bytes to compare +} + +func (b bytesSort) Len() int { + return len(b.b) +} + +func (b bytesSort) Swap(i, j int) { + b.b[i], b.b[j] = b.b[j], b.b[i] +} + +func (b bytesSort) Less(i, j int) bool { + for k := 0; k < b.n; k++ { + if b.b[i][k] == b.b[j][k] { + continue + } + return b.b[i][k] < b.b[j][k] + } + return false +} + +// parseExtensions parses and normalizes the extensions in the buffer. +// It returns the last position of scan.b that is part of any extension. +// It also trims scan.b to remove excess parts accordingly. +func parseExtensions(scan *scanner) int { + start := scan.start + exts := [][]byte{} + private := []byte{} + end := scan.end + for len(scan.token) == 1 { + extStart := scan.start + ext := scan.token[0] + end = parseExtension(scan) + extension := scan.b[extStart:end] + if len(extension) < 3 || (ext != 'x' && len(extension) < 4) { + scan.setError(ErrSyntax) + end = extStart + continue + } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) { + scan.b = scan.b[:end] + return end + } else if ext == 'x' { + private = extension + break + } + exts = append(exts, extension) + } + sort.Sort(bytesSort{exts, 1}) + if len(private) > 0 { + exts = append(exts, private) + } + scan.b = scan.b[:start] + if len(exts) > 0 { + scan.b = append(scan.b, bytes.Join(exts, separator)...) + } else if start > 0 { + // Strip trailing '-'. + scan.b = scan.b[:start-1] + } + return end +} + +// parseExtension parses a single extension and returns the position of +// the extension end. +func parseExtension(scan *scanner) int { + start, end := scan.start, scan.end + switch scan.token[0] { + case 'u': // https://www.ietf.org/rfc/rfc6067.txt + attrStart := end + scan.scan() + for last := []byte{}; len(scan.token) > 2; scan.scan() { + if bytes.Compare(scan.token, last) != -1 { + // Attributes are unsorted. Start over from scratch. + p := attrStart + 1 + scan.next = p + attrs := [][]byte{} + for scan.scan(); len(scan.token) > 2; scan.scan() { + attrs = append(attrs, scan.token) + end = scan.end + } + sort.Sort(bytesSort{attrs, 3}) + copy(scan.b[p:], bytes.Join(attrs, separator)) + break + } + last = scan.token + end = scan.end + } + // Scan key-type sequences. A key is of length 2 and may be followed + // by 0 or more "type" subtags from 3 to the maximum of 8 letters. + var last, key []byte + for attrEnd := end; len(scan.token) == 2; last = key { + key = scan.token + end = scan.end + for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() { + end = scan.end + } + // TODO: check key value validity + if bytes.Compare(key, last) != 1 || scan.err != nil { + // We have an invalid key or the keys are not sorted. + // Start scanning keys from scratch and reorder. + p := attrEnd + 1 + scan.next = p + keys := [][]byte{} + for scan.scan(); len(scan.token) == 2; { + keyStart := scan.start + end = scan.end + for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() { + end = scan.end + } + keys = append(keys, scan.b[keyStart:end]) + } + sort.Stable(bytesSort{keys, 2}) + if n := len(keys); n > 0 { + k := 0 + for i := 1; i < n; i++ { + if !bytes.Equal(keys[k][:2], keys[i][:2]) { + k++ + keys[k] = keys[i] + } else if !bytes.Equal(keys[k], keys[i]) { + scan.setError(ErrDuplicateKey) + } + } + keys = keys[:k+1] + } + reordered := bytes.Join(keys, separator) + if e := p + len(reordered); e < end { + scan.deleteRange(e, end) + end = e + } + copy(scan.b[p:], reordered) + break + } + } + case 't': // https://www.ietf.org/rfc/rfc6497.txt + scan.scan() + if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) { + _, end = parseTag(scan, false) + scan.toLower(start, end) + } + for len(scan.token) == 2 && !isAlpha(scan.token[1]) { + end = scan.acceptMinSize(3) + } + case 'x': + end = scan.acceptMinSize(1) + default: + end = scan.acceptMinSize(2) + } + return end +} + +// getExtension returns the name, body and end position of the extension. +func getExtension(s string, p int) (end int, ext string) { + if s[p] == '-' { + p++ + } + if s[p] == 'x' { + return len(s), s[p:] + } + end = nextExtension(s, p) + return end, s[p:end] +} + +// nextExtension finds the next extension within the string, searching +// for the -- pattern from position p. +// In the fast majority of cases, language tags will have at most +// one extension and extensions tend to be small. +func nextExtension(s string, p int) int { + for n := len(s) - 3; p < n; { + if s[p] == '-' { + if s[p+2] == '-' { + return p + } + p += 3 + } else { + p++ + } + } + return len(s) +} diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go new file mode 100644 index 0000000..14167e7 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/tables.go @@ -0,0 +1,3494 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +import "golang.org/x/text/internal/tag" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +const NumLanguages = 8798 + +const NumScripts = 261 + +const NumRegions = 358 + +type FromTo struct { + From uint16 + To uint16 +} + +const nonCanonicalUnd = 1201 +const ( + _af = 22 + _am = 39 + _ar = 58 + _az = 88 + _bg = 126 + _bn = 165 + _ca = 215 + _cs = 250 + _da = 257 + _de = 269 + _el = 310 + _en = 313 + _es = 318 + _et = 320 + _fa = 328 + _fi = 337 + _fil = 339 + _fr = 350 + _gu = 420 + _he = 444 + _hi = 446 + _hr = 465 + _hu = 469 + _hy = 471 + _id = 481 + _is = 504 + _it = 505 + _ja = 512 + _ka = 528 + _kk = 578 + _km = 586 + _kn = 593 + _ko = 596 + _ky = 650 + _lo = 696 + _lt = 704 + _lv = 711 + _mk = 767 + _ml = 772 + _mn = 779 + _mo = 784 + _mr = 795 + _ms = 799 + _mul = 806 + _my = 817 + _nb = 839 + _ne = 849 + _nl = 871 + _no = 879 + _pa = 925 + _pl = 947 + _pt = 960 + _ro = 988 + _ru = 994 + _sh = 1031 + _si = 1036 + _sk = 1042 + _sl = 1046 + _sq = 1073 + _sr = 1074 + _sv = 1092 + _sw = 1093 + _ta = 1104 + _te = 1121 + _th = 1131 + _tl = 1146 + _tn = 1152 + _tr = 1162 + _uk = 1198 + _ur = 1204 + _uz = 1212 + _vi = 1219 + _zh = 1321 + _zu = 1327 + _jbo = 515 + _ami = 1650 + _bnn = 2357 + _hak = 438 + _tlh = 14467 + _lb = 661 + _nv = 899 + _pwn = 12055 + _tao = 14188 + _tay = 14198 + _tsu = 14662 + _nn = 874 + _sfb = 13629 + _vgt = 15701 + _sgg = 13660 + _cmn = 3007 + _nan = 835 + _hsn = 467 +) + +const langPrivateStart = 0x2f72 + +const langPrivateEnd = 0x3179 + +// lang holds an alphabetically sorted list of ISO-639 language identifiers. +// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. +// For 2-byte language identifiers, the two successive bytes have the following meaning: +// - if the first letter of the 2- and 3-letter ISO codes are the same: +// the second and third letter of the 3-letter ISO code. +// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. +// +// For 3-byte language identifiers the 4th byte is 0. +const lang tag.Index = "" + // Size: 5324 bytes + "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" + + "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" + + "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" + + "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" + + "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" + + "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" + + "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" + + "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" + + "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" + + "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" + + "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" + + "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" + + "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" + + "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" + + "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" + + "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" + + "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" + + "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" + + "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" + + "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" + + "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" + + "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" + + "kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" + + "j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" + + "andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" + + "ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" + + "\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" + + "\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" + + "yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" + + "llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" + + "\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" + + "\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" + + "foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" + + "ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" + + "ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" + + "\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" + + "ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" + + "\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" + + "\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" + + "\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" + + "\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" + + "aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" + + "l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" + + "hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" + + "\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" + + "eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" + + "lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" + + "ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" + + "\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" + + "\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" + + "\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" + + "\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" + + "ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" + + "\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" + + "klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" + + "nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" + + "\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" + + "rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" + + "\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" + + "us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" + + "\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" + + "\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" + + "ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" + + "d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" + + "\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" + + "\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" + + "lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" + + "w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" + + "\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" + + "\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" + + "\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" + + "min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" + + "ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" + + "e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" + + "mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" + + "us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" + + "\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" + + "\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" + + "bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" + + "\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" + + "if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" + + "dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" + + "nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" + + "\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" + + "\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" + + "opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" + + "\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" + + "\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" + + "\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" + + "ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" + + "f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" + + "rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" + + "ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" + + "\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" + + "ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" + + "i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" + + "\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" + + "\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" + + "\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" + + "\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" + + "\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" + + "sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" + + "yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" + + "\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" + + "ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" + + "q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" + + "\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" + + "tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" + + "sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" + + "\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" + + "wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" + + "\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" + + "vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" + + "\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" + + "\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" + + "\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" + + "\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" + + "bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" + + "\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" + + "\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" + + "\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" + + "ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" + + "\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" + + "\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff" + +const langNoIndexOffset = 1330 + +// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index +// in lookup tables. The language ids for these language codes are derived directly +// from the letters and are not consecutive. +// Size: 2197 bytes, 2197 elements +var langNoIndex = [2197]uint8{ + // Entry 0 - 3F + 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, + 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, + 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x72, + 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, + 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, + 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xbc, 0x0a, 0x6a, + 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff, + // Entry 40 - 7F + 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0, + 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed, + 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35, + 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff, + 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5, + 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3, + 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, + 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, + // Entry 80 - BF + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x7f, 0xff, 0xff, + 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, + 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, + 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, + 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff, + 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5, + 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c, + 0x08, 0x21, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80, + // Entry C0 - FF + 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, + 0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56, + 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7f, 0xf3, 0xef, + 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, + 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x7b, 0x35, + 0x3e, 0xc7, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00, + 0xb0, 0x05, 0x80, 0x00, 0x20, 0x00, 0x00, 0x03, + 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, + // Entry 100 - 13F + 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, + 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00, + 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3, + 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x41, 0x0c, + 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f, + 0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, + 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, + 0x90, 0x6d, 0x01, 0x2e, 0x96, 0x69, 0x20, 0xfb, + // Entry 140 - 17F + 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16, + 0x03, 0x00, 0x00, 0xb0, 0x14, 0x23, 0x50, 0x06, + 0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09, + 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, + 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x05, + 0x08, 0x00, 0x00, 0x05, 0x00, 0x80, 0x28, 0x04, + 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, + 0x24, 0x52, 0xf4, 0xd5, 0xbf, 0x62, 0xc9, 0x03, + // Entry 180 - 1BF + 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, + 0x21, 0x18, 0x81, 0x08, 0x00, 0x01, 0x40, 0x82, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, + 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x03, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00, + 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55, + 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40, + 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf, + // Entry 200 - 23F + 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27, + 0xed, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5, + 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe1, 0xdf, + 0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x81, 0xe3, + 0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d, + 0x79, 0xed, 0x1c, 0x7f, 0x04, 0x08, 0x00, 0x01, + 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, + 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, + // Entry 240 - 27F + 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00, + 0x20, 0x7b, 0x78, 0x02, 0x07, 0x84, 0x00, 0xf0, + 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00, + 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04, + 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00, + 0x91, 0x24, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff, + 0x7b, 0x7f, 0x70, 0x00, 0x05, 0x9b, 0xdd, 0x66, + // Entry 280 - 2BF + 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05, + 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51, + 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05, + 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, + 0x0c, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60, + 0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80, + 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, + 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, + // Entry 2C0 - 2FF + 0x02, 0x50, 0x80, 0x11, 0x00, 0x99, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x0e, 0x59, 0xe9, + 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, + 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, + 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, + 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x40, 0x08, + 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x8d, 0x12, 0x00, + // Entry 300 - 33F + 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, + 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00, + 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80, + 0x00, 0x01, 0xd0, 0x16, 0x40, 0x00, 0x10, 0xb0, + 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00, + 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80, + 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00, + 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00, + // Entry 340 - 37F + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01, + 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3, + 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb, + 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6, + 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff, + 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff, + 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f, + 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f, + // Entry 380 - 3BF + 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f, + 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d, + 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf, + 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, + 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, + 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x7d, 0x1f, + 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, + // Entry 3C0 - 3FF + 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, + 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x20, + 0x40, 0x54, 0x9f, 0x8a, 0xdf, 0xf9, 0x6e, 0x11, + 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x03, + 0x05, 0xd1, 0x50, 0x5c, 0x00, 0x40, 0x00, 0x10, + 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, + 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, + // Entry 400 - 43F + 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f, + 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7, + 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f, + 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b, + 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7, + 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe, + 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde, + 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf, + // Entry 440 - 47F + 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d, + 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd, + 0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf, + 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7, + 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce, + 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xfd, + 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff, + 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4, + // Entry 480 - 4BF + 0x93, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb, + 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, + 0x14, 0x00, 0x55, 0x51, 0xc2, 0x65, 0xf5, 0x41, + 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x85, 0xc5, 0x05, + 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x05, + 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, + 0x06, 0x11, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, + // Entry 4C0 - 4FF + 0xfd, 0x47, 0x69, 0x06, 0x95, 0x06, 0x57, 0xed, + 0xfb, 0x4d, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, + 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83, + 0xb8, 0x4f, 0x10, 0x8e, 0x89, 0x46, 0xde, 0xf7, + 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00, + 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d, + 0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, + // Entry 500 - 53F + 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, + 0x2d, 0x14, 0x27, 0x5f, 0xed, 0xf1, 0x3f, 0xe7, + 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, + 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7, + 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, + 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9, + 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, + 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, + // Entry 540 - 57F + 0x00, 0x00, 0x01, 0x43, 0x19, 0x24, 0x08, 0x00, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + // Entry 580 - 5BF + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d, + 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80, + 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, + 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, + 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x20, 0x81, + 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, + // Entry 5C0 - 5FF + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0xbe, 0x02, + 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, + 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, + 0x3d, 0x40, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, + 0x31, 0x00, 0x00, 0x00, 0x01, 0x18, 0x02, 0x20, + 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, + 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, + 0x1f, 0x98, 0xcf, 0x9c, 0xff, 0xaf, 0x5f, 0xfe, + // Entry 600 - 63F + 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9, + 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1, + 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7, + 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd, + 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x9f, + 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe, + 0xbe, 0x5f, 0x46, 0x5b, 0xe9, 0x5f, 0x50, 0x18, + 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f, + // Entry 640 - 67F + 0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf5, 0x57, 0x6c, + 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde, + 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x3f, 0x00, 0x98, + 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, + 0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4, + 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, + 0x5f, 0xff, 0xff, 0x9e, 0xdf, 0xf6, 0xd7, 0xb9, + 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, + // Entry 680 - 6BF + 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, + 0xce, 0x7f, 0x44, 0x1d, 0x73, 0x7f, 0xf8, 0xda, + 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x79, 0xa0, + 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, + 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x09, 0x06, + 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, + 0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f, + // Entry 6C0 - 6FF + 0x54, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, + 0x40, 0x02, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, + 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41, + 0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, + 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab, + 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, + // Entry 700 - 73F + 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x01, 0x00, 0x01, + 0xff, 0x18, 0x02, 0x00, 0x02, 0xf0, 0xfd, 0x79, + 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, + 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 740 - 77F + 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, + 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x46, + 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, + 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, + 0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75, + 0x97, 0x7c, 0xdf, 0x31, 0xcc, 0x68, 0xd1, 0x03, + 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, + // Entry 780 - 7BF + 0x83, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, + 0x10, 0x03, 0x31, 0x02, 0x01, 0x00, 0x00, 0xf0, + 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, + 0x78, 0x15, 0x50, 0x05, 0xa4, 0x84, 0xa9, 0x41, + 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x40, + 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, + 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, + // Entry 7C0 - 7FF + 0xdd, 0xbf, 0xf2, 0x5d, 0xc7, 0x0c, 0xd5, 0x42, + 0xfc, 0xff, 0xf7, 0x1f, 0x00, 0x80, 0x40, 0x56, + 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff, + 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, + 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, + 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, + 0xfe, 0x01, 0x02, 0x88, 0x2a, 0x40, 0x16, 0x01, + 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, + // Entry 800 - 83F + 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xdc, 0xa3, 0xd1, + 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, + 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, + 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, + 0x2f, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93, + 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, + 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, + // Entry 840 - 87F + 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x89, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x03, + 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, + 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, + 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x54, 0xf1, + 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, + 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, + 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, + // Entry 880 - 8BF + 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24, + 0x0a, 0x00, 0x80, 0x00, 0x00, +} + +// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives +// to 2-letter language codes that cannot be derived using the method described above. +// Each 3-letter code is followed by its 1-byte langID. +const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff" + +// altLangIndex is used to convert indexes in altLangISO3 to langIDs. +// Size: 12 bytes, 6 elements +var altLangIndex = [6]uint16{ + 0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208, +} + +// AliasMap maps langIDs to their suggested replacements. +// Size: 772 bytes, 193 elements +var AliasMap = [193]FromTo{ + 0: {From: 0x82, To: 0x88}, + 1: {From: 0x187, To: 0x1ae}, + 2: {From: 0x1f3, To: 0x1e1}, + 3: {From: 0x1fb, To: 0x1bc}, + 4: {From: 0x208, To: 0x512}, + 5: {From: 0x20f, To: 0x20e}, + 6: {From: 0x310, To: 0x3dc}, + 7: {From: 0x347, To: 0x36f}, + 8: {From: 0x407, To: 0x432}, + 9: {From: 0x47a, To: 0x153}, + 10: {From: 0x490, To: 0x451}, + 11: {From: 0x4a2, To: 0x21}, + 12: {From: 0x53e, To: 0x544}, + 13: {From: 0x58f, To: 0x12d}, + 14: {From: 0x62b, To: 0x34}, + 15: {From: 0x62f, To: 0x14}, + 16: {From: 0x630, To: 0x1eb1}, + 17: {From: 0x651, To: 0x431}, + 18: {From: 0x662, To: 0x431}, + 19: {From: 0x6ed, To: 0x3a}, + 20: {From: 0x6f8, To: 0x1d7}, + 21: {From: 0x709, To: 0x3625}, + 22: {From: 0x73e, To: 0x21a1}, + 23: {From: 0x7b3, To: 0x56}, + 24: {From: 0x7b9, To: 0x299b}, + 25: {From: 0x7c5, To: 0x58}, + 26: {From: 0x7e6, To: 0x145}, + 27: {From: 0x80c, To: 0x5a}, + 28: {From: 0x815, To: 0x8d}, + 29: {From: 0x87e, To: 0x810}, + 30: {From: 0x8a8, To: 0x8b7}, + 31: {From: 0x8c3, To: 0xee3}, + 32: {From: 0x8fa, To: 0x1dc}, + 33: {From: 0x9ef, To: 0x331}, + 34: {From: 0xa36, To: 0x2c5}, + 35: {From: 0xa3d, To: 0xbf}, + 36: {From: 0xabe, To: 0x3322}, + 37: {From: 0xb38, To: 0x529}, + 38: {From: 0xb75, To: 0x265a}, + 39: {From: 0xb7e, To: 0xbc3}, + 40: {From: 0xb9b, To: 0x44e}, + 41: {From: 0xbbc, To: 0x4229}, + 42: {From: 0xbbf, To: 0x529}, + 43: {From: 0xbfe, To: 0x2da7}, + 44: {From: 0xc2e, To: 0x3181}, + 45: {From: 0xcb9, To: 0xf3}, + 46: {From: 0xd08, To: 0xfa}, + 47: {From: 0xdc8, To: 0x11a}, + 48: {From: 0xdd7, To: 0x32d}, + 49: {From: 0xdf8, To: 0xdfb}, + 50: {From: 0xdfe, To: 0x531}, + 51: {From: 0xe01, To: 0xdf3}, + 52: {From: 0xedf, To: 0x205a}, + 53: {From: 0xee9, To: 0x222e}, + 54: {From: 0xeee, To: 0x2e9a}, + 55: {From: 0xf39, To: 0x367}, + 56: {From: 0x10d0, To: 0x140}, + 57: {From: 0x1104, To: 0x2d0}, + 58: {From: 0x11a0, To: 0x1ec}, + 59: {From: 0x1279, To: 0x21}, + 60: {From: 0x1424, To: 0x15e}, + 61: {From: 0x1470, To: 0x14e}, + 62: {From: 0x151f, To: 0xd9b}, + 63: {From: 0x1523, To: 0x390}, + 64: {From: 0x1532, To: 0x19f}, + 65: {From: 0x1580, To: 0x210}, + 66: {From: 0x1583, To: 0x10d}, + 67: {From: 0x15a3, To: 0x3caf}, + 68: {From: 0x1630, To: 0x222e}, + 69: {From: 0x166a, To: 0x19b}, + 70: {From: 0x16c8, To: 0x136}, + 71: {From: 0x1700, To: 0x29f8}, + 72: {From: 0x1718, To: 0x194}, + 73: {From: 0x1727, To: 0xf3f}, + 74: {From: 0x177a, To: 0x178}, + 75: {From: 0x1809, To: 0x17b6}, + 76: {From: 0x1816, To: 0x18f3}, + 77: {From: 0x188a, To: 0x436}, + 78: {From: 0x1979, To: 0x1d01}, + 79: {From: 0x1a74, To: 0x2bb0}, + 80: {From: 0x1a8a, To: 0x1f8}, + 81: {From: 0x1b5a, To: 0x1fa}, + 82: {From: 0x1b86, To: 0x1515}, + 83: {From: 0x1d64, To: 0x2c9b}, + 84: {From: 0x2038, To: 0x37b1}, + 85: {From: 0x203d, To: 0x20dd}, + 86: {From: 0x2042, To: 0x2e00}, + 87: {From: 0x205a, To: 0x30b}, + 88: {From: 0x20e3, To: 0x274}, + 89: {From: 0x20ee, To: 0x263}, + 90: {From: 0x20f2, To: 0x22d}, + 91: {From: 0x20f9, To: 0x256}, + 92: {From: 0x210f, To: 0x21eb}, + 93: {From: 0x2135, To: 0x27d}, + 94: {From: 0x2160, To: 0x913}, + 95: {From: 0x2199, To: 0x121}, + 96: {From: 0x21ce, To: 0x1561}, + 97: {From: 0x21e6, To: 0x504}, + 98: {From: 0x21f4, To: 0x49f}, + 99: {From: 0x21fb, To: 0x269}, + 100: {From: 0x222d, To: 0x121}, + 101: {From: 0x2237, To: 0x121}, + 102: {From: 0x2248, To: 0x217d}, + 103: {From: 0x2262, To: 0x92a}, + 104: {From: 0x2316, To: 0x3226}, + 105: {From: 0x236a, To: 0x2835}, + 106: {From: 0x2382, To: 0x3365}, + 107: {From: 0x2472, To: 0x2c7}, + 108: {From: 0x24e4, To: 0x2ff}, + 109: {From: 0x24f0, To: 0x2fa}, + 110: {From: 0x24fa, To: 0x31f}, + 111: {From: 0x2550, To: 0xb5b}, + 112: {From: 0x25a9, To: 0xe2}, + 113: {From: 0x263e, To: 0x2d0}, + 114: {From: 0x26c9, To: 0x26b4}, + 115: {From: 0x26f9, To: 0x3c8}, + 116: {From: 0x2727, To: 0x3caf}, + 117: {From: 0x2755, To: 0x6a4}, + 118: {From: 0x2765, To: 0x26b4}, + 119: {From: 0x2789, To: 0x4358}, + 120: {From: 0x27c9, To: 0x2001}, + 121: {From: 0x28ea, To: 0x27b1}, + 122: {From: 0x28ef, To: 0x2837}, + 123: {From: 0x28fe, To: 0xaa5}, + 124: {From: 0x2914, To: 0x351}, + 125: {From: 0x2986, To: 0x2da7}, + 126: {From: 0x29f0, To: 0x96b}, + 127: {From: 0x2b1a, To: 0x38d}, + 128: {From: 0x2bfc, To: 0x395}, + 129: {From: 0x2c3f, To: 0x3caf}, + 130: {From: 0x2ce1, To: 0x2201}, + 131: {From: 0x2cfc, To: 0x3be}, + 132: {From: 0x2d13, To: 0x597}, + 133: {From: 0x2d47, To: 0x148}, + 134: {From: 0x2d48, To: 0x148}, + 135: {From: 0x2dff, To: 0x2f1}, + 136: {From: 0x2e08, To: 0x19cc}, + 137: {From: 0x2e10, To: 0xc45}, + 138: {From: 0x2e1a, To: 0x2d95}, + 139: {From: 0x2e21, To: 0x292}, + 140: {From: 0x2e54, To: 0x7d}, + 141: {From: 0x2e65, To: 0x2282}, + 142: {From: 0x2e97, To: 0x1a4}, + 143: {From: 0x2ea0, To: 0x2e9b}, + 144: {From: 0x2eef, To: 0x2ed7}, + 145: {From: 0x3193, To: 0x3c4}, + 146: {From: 0x3366, To: 0x338e}, + 147: {From: 0x342a, To: 0x3dc}, + 148: {From: 0x34ee, To: 0x18d0}, + 149: {From: 0x35c8, To: 0x2c9b}, + 150: {From: 0x35e6, To: 0x412}, + 151: {From: 0x35f5, To: 0x24b}, + 152: {From: 0x360d, To: 0x1dc}, + 153: {From: 0x3658, To: 0x246}, + 154: {From: 0x3676, To: 0x3f4}, + 155: {From: 0x36fd, To: 0x445}, + 156: {From: 0x3747, To: 0x3b42}, + 157: {From: 0x37c0, To: 0x121}, + 158: {From: 0x3816, To: 0x38f2}, + 159: {From: 0x382a, To: 0x2b48}, + 160: {From: 0x382b, To: 0x2c9b}, + 161: {From: 0x382f, To: 0xa9}, + 162: {From: 0x3832, To: 0x3228}, + 163: {From: 0x386c, To: 0x39a6}, + 164: {From: 0x3892, To: 0x3fc0}, + 165: {From: 0x38a0, To: 0x45f}, + 166: {From: 0x38a5, To: 0x39d7}, + 167: {From: 0x38b4, To: 0x1fa4}, + 168: {From: 0x38b5, To: 0x2e9a}, + 169: {From: 0x38fa, To: 0x38f1}, + 170: {From: 0x395c, To: 0x47e}, + 171: {From: 0x3b4e, To: 0xd91}, + 172: {From: 0x3b78, To: 0x137}, + 173: {From: 0x3c99, To: 0x4bc}, + 174: {From: 0x3fbd, To: 0x100}, + 175: {From: 0x4208, To: 0xa91}, + 176: {From: 0x42be, To: 0x573}, + 177: {From: 0x42f9, To: 0x3f60}, + 178: {From: 0x4378, To: 0x25a}, + 179: {From: 0x43b8, To: 0xe6c}, + 180: {From: 0x43cd, To: 0x10f}, + 181: {From: 0x43d4, To: 0x4848}, + 182: {From: 0x44af, To: 0x3322}, + 183: {From: 0x44e3, To: 0x512}, + 184: {From: 0x45ca, To: 0x2409}, + 185: {From: 0x45dd, To: 0x26dc}, + 186: {From: 0x4610, To: 0x48ae}, + 187: {From: 0x46ae, To: 0x46a0}, + 188: {From: 0x473e, To: 0x4745}, + 189: {From: 0x4817, To: 0x3503}, + 190: {From: 0x483b, To: 0x208b}, + 191: {From: 0x4916, To: 0x31f}, + 192: {From: 0x49a7, To: 0x523}, +} + +// Size: 193 bytes, 193 elements +var AliasTypes = [193]AliasType{ + // Entry 0 - 3F + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 0, 0, + 1, 2, 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, + 0, 2, 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, + 1, 1, 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, + // Entry 40 - 7F + 1, 2, 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, + 2, 1, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, + 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, + // Entry 80 - BF + 1, 0, 0, 1, 0, 2, 1, 1, 0, 0, 0, 1, 0, 0, 0, 0, + 0, 1, 1, 2, 0, 0, 2, 0, 0, 1, 1, 1, 0, 0, 0, 0, + 0, 2, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 2, 0, + 0, 0, 1, 0, 1, 0, 0, 1, 0, 0, 0, 0, 1, 0, 0, 1, + // Entry C0 - FF + 1, +} + +const ( + _Latn = 91 + _Hani = 57 + _Hans = 59 + _Hant = 60 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 +) + +// script is an alphabetically sorted list of ISO 15924 codes. The index +// of the script in the string, divided by 4, is the internal scriptID. +const script tag.Index = "" + // Size: 1052 bytes + "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + + "BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" + + "DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" + + "GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" + + "JavaJpanJurcKaliKanaKawiKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatf" + + "LatgLatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedf" + + "MendMercMeroMlymModiMongMoonMrooMteiMultMymrNagmNandNarbNbatNewaNkdbNkgb" + + "NkooNshuOgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlv" + + "PhnxPiqdPlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" + + "QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" + + "QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" + + "QabxRanjRjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogd" + + "SogoSoraSoyoSundSunuSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTelu" + + "TengTfngTglgThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsux" + + "YeziYiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" + +// suppressScript is an index from langID to the dominant script for that language, +// if it exists. If a script is given, it should be suppressed from the language tag. +// Size: 1330 bytes, 1330 elements +var suppressScript = [1330]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 40 - 7F + 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, + // Entry 80 - BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry C0 - FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 100 - 13F + 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xed, 0x00, 0x00, 0x00, 0x00, 0xef, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x5b, 0x00, + // Entry 140 - 17F + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 180 - 1BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x35, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x5b, 0x00, 0x5b, 0x5b, 0x00, 0x08, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, + // Entry 200 - 23F + 0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x2e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 240 - 27F + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x53, 0x00, 0x00, 0x54, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 280 - 2BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x58, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 2C0 - 2FF + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, + // Entry 300 - 33F + 0x00, 0x00, 0x00, 0x00, 0x6f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5b, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x76, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + // Entry 340 - 37F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x5b, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 380 - 3BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x83, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, + // Entry 3C0 - 3FF + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 400 - 43F + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + // Entry 440 - 47F + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xe6, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xe9, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xee, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + // Entry 480 - 4BF + 0x5b, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 4C0 - 4FF + 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 500 - 53F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, +} + +const ( + _001 = 1 + _419 = 31 + _BR = 65 + _CA = 73 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 +) + +// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID +// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for +// the UN.M49 codes used for groups.) +const isoRegionOffset = 32 + +// regionTypes defines the status of a region for various standards. +// Size: 359 bytes, 359 elements +var regionTypes = [359]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 40 - 7F + 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x04, 0x06, + 0x04, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x04, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 80 - BF + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry C0 - FF + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + // Entry 100 - 13F + 0x05, 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + // Entry 140 - 17F + 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, + 0x06, 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, +} + +// regionISO holds a list of alphabetically sorted 2-letter ISO region codes. +// Each 2-letter codes is followed by two bytes with the following meaning: +// - [A-Z}{2}: the first letter of the 2-letter code plus these two +// letters form the 3-letter ISO code. +// - 0, n: index into altRegionISO3. +const regionISO tag.Index = "" + // Size: 1312 bytes + "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + + "CQ CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADO" + + "OMDYHYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSM" + + "FOROFQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQ" + + "NQGRRCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERL" + + "ILSRIMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM" + + "\x00\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSO" + + "LTTULUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNP" + + "MQTQMRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLD" + + "NOORNPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM" + + "\x00\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSS" + + "QTTTQU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLB" + + "SCYCSDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXM" + + "SYYRSZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTT" + + "TOTVUVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVN" + + "NMVUUTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXN" + + "NNXOOOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUG" + + "ZAAFZMMBZRARZWWEZZZZ\xff\xff\xff\xff" + +// altRegionISO3 holds a list of 3-letter region codes that cannot be +// mapped to 2-letter codes using the default algorithm. This is a short list. +const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" + +// altRegionIDs holds a list of regionIDs the positions of which match those +// of the 3-letter ISO codes in altRegionISO3. +// Size: 22 bytes, 11 elements +var altRegionIDs = [11]uint16{ + 0x0058, 0x0071, 0x0089, 0x00a9, 0x00ab, 0x00ae, 0x00eb, 0x0106, + 0x0122, 0x0160, 0x00dd, +} + +// Size: 80 bytes, 20 elements +var regionOldMap = [20]FromTo{ + 0: {From: 0x44, To: 0xc5}, + 1: {From: 0x59, To: 0xa8}, + 2: {From: 0x60, To: 0x61}, + 3: {From: 0x67, To: 0x3b}, + 4: {From: 0x7a, To: 0x79}, + 5: {From: 0x94, To: 0x37}, + 6: {From: 0xa4, To: 0x134}, + 7: {From: 0xc2, To: 0x134}, + 8: {From: 0xd8, To: 0x140}, + 9: {From: 0xdd, To: 0x2b}, + 10: {From: 0xf0, To: 0x134}, + 11: {From: 0xf3, To: 0xe3}, + 12: {From: 0xfd, To: 0x71}, + 13: {From: 0x104, To: 0x165}, + 14: {From: 0x12b, To: 0x127}, + 15: {From: 0x133, To: 0x7c}, + 16: {From: 0x13b, To: 0x13f}, + 17: {From: 0x142, To: 0x134}, + 18: {From: 0x15e, To: 0x15f}, + 19: {From: 0x164, To: 0x4b}, +} + +// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are +// codes indicating collections of regions. +// Size: 718 bytes, 359 elements +var m49 = [359]int16{ + // Entry 0 - 3F + 0, 1, 2, 3, 5, 9, 11, 13, + 14, 15, 17, 18, 19, 21, 29, 30, + 34, 35, 39, 53, 54, 57, 61, 142, + 143, 145, 150, 151, 154, 155, 202, 419, + 958, 0, 20, 784, 4, 28, 660, 8, + 51, 530, 24, 10, 32, 16, 40, 36, + 533, 248, 31, 70, 52, 50, 56, 854, + 100, 48, 108, 204, 652, 60, 96, 68, + // Entry 40 - 7F + 535, 76, 44, 64, 104, 74, 72, 112, + 84, 124, 166, 180, 140, 178, 756, 384, + 184, 152, 120, 156, 170, 0, 0, 188, + 891, 296, 192, 132, 531, 162, 196, 203, + 278, 276, 0, 262, 208, 212, 214, 204, + 12, 0, 218, 233, 818, 732, 232, 724, + 231, 967, 0, 246, 242, 238, 583, 234, + 0, 250, 249, 266, 826, 308, 268, 254, + // Entry 80 - BF + 831, 288, 292, 304, 270, 324, 312, 226, + 300, 239, 320, 316, 624, 328, 344, 334, + 340, 191, 332, 348, 854, 0, 360, 372, + 376, 833, 356, 86, 368, 364, 352, 380, + 832, 388, 400, 392, 581, 404, 417, 116, + 296, 174, 659, 408, 410, 414, 136, 398, + 418, 422, 662, 438, 144, 430, 426, 440, + 442, 428, 434, 504, 492, 498, 499, 663, + // Entry C0 - FF + 450, 584, 581, 807, 466, 104, 496, 446, + 580, 474, 478, 500, 470, 480, 462, 454, + 484, 458, 508, 516, 540, 562, 574, 566, + 548, 558, 528, 578, 524, 10, 520, 536, + 570, 554, 512, 591, 0, 604, 258, 598, + 608, 586, 616, 666, 612, 630, 275, 620, + 581, 585, 600, 591, 634, 959, 960, 961, + 962, 963, 964, 965, 966, 967, 968, 969, + // Entry 100 - 13F + 970, 971, 972, 638, 716, 642, 688, 643, + 646, 682, 90, 690, 729, 752, 702, 654, + 705, 744, 703, 694, 674, 686, 706, 740, + 728, 678, 810, 222, 534, 760, 748, 0, + 796, 148, 260, 768, 764, 762, 772, 626, + 795, 788, 776, 626, 792, 780, 798, 158, + 834, 804, 800, 826, 581, 0, 840, 858, + 860, 336, 670, 704, 862, 92, 850, 704, + // Entry 140 - 17F + 548, 876, 581, 882, 973, 974, 975, 976, + 977, 978, 979, 980, 981, 982, 983, 984, + 985, 986, 987, 988, 989, 990, 991, 992, + 993, 994, 995, 996, 997, 998, 720, 887, + 175, 891, 710, 894, 180, 716, 999, +} + +// m49Index gives indexes into fromM49 based on the three most significant bits +// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in +// +// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] +// +// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. +// The region code is stored in the 9 lsb of the indexed value. +// Size: 18 bytes, 9 elements +var m49Index = [9]int16{ + 0, 59, 108, 143, 181, 220, 259, 291, + 333, +} + +// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details. +// Size: 666 bytes, 333 elements +var fromM49 = [333]uint16{ + // Entry 0 - 3F + 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, + 0x1606, 0x1868, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, + 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, + 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, + 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, + 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, + 0xac9b, 0xb50a, 0xb93d, 0xc03e, 0xc838, 0xd0c5, 0xd83a, 0xe047, + 0xe8a7, 0xf052, 0xf849, 0x085b, 0x10ae, 0x184c, 0x1c17, 0x1e18, + // Entry 40 - 7F + 0x20b4, 0x2219, 0x2921, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, + 0x3853, 0x3d2f, 0x445d, 0x4c4a, 0x5454, 0x5ca9, 0x5f60, 0x644d, + 0x684b, 0x7050, 0x7857, 0x7e91, 0x805a, 0x885e, 0x941e, 0x965f, + 0x983b, 0xa064, 0xa865, 0xac66, 0xb46a, 0xbd1b, 0xc487, 0xcc70, + 0xce70, 0xd06e, 0xd26b, 0xd477, 0xdc75, 0xde89, 0xe474, 0xec73, + 0xf031, 0xf27a, 0xf479, 0xfc7f, 0x04e6, 0x0922, 0x0c63, 0x147b, + 0x187e, 0x1c84, 0x26ee, 0x2861, 0x2c60, 0x3061, 0x4081, 0x4882, + 0x50a8, 0x5888, 0x6083, 0x687d, 0x7086, 0x788b, 0x808a, 0x8885, + // Entry 80 - BF + 0x908d, 0x9892, 0x9c8f, 0xa139, 0xa890, 0xb08e, 0xb893, 0xc09e, + 0xc89a, 0xd096, 0xd89d, 0xe09c, 0xe897, 0xf098, 0xf89f, 0x004f, + 0x08a1, 0x10a3, 0x1caf, 0x20a2, 0x28a5, 0x30ab, 0x34ac, 0x3cad, + 0x42a6, 0x44b0, 0x461f, 0x4cb1, 0x54b6, 0x58b9, 0x5cb5, 0x64ba, + 0x6cb3, 0x70b7, 0x74b8, 0x7cc7, 0x84c0, 0x8ccf, 0x94d1, 0x9cce, + 0xa4c4, 0xaccc, 0xb4c9, 0xbcca, 0xc0cd, 0xc8d0, 0xd8bc, 0xe0c6, + 0xe4bd, 0xe6be, 0xe8cb, 0xf0bb, 0xf8d2, 0x00e2, 0x08d3, 0x10de, + 0x18dc, 0x20da, 0x2429, 0x265c, 0x2a30, 0x2d1c, 0x2e40, 0x30df, + // Entry C0 - FF + 0x38d4, 0x4940, 0x54e1, 0x5cd9, 0x64d5, 0x6cd7, 0x74e0, 0x7cd6, + 0x84db, 0x88c8, 0x8b34, 0x8e76, 0x90c1, 0x92f1, 0x94e9, 0x9ee3, + 0xace7, 0xb0f2, 0xb8e5, 0xc0e8, 0xc8ec, 0xd0ea, 0xd8ef, 0xe08c, + 0xe527, 0xeced, 0xf4f4, 0xfd03, 0x0505, 0x0707, 0x0d08, 0x183c, + 0x1d0f, 0x26aa, 0x2826, 0x2cb2, 0x2ebf, 0x34eb, 0x3d3a, 0x4514, + 0x4d19, 0x5509, 0x5d15, 0x6106, 0x650b, 0x6d13, 0x7d0e, 0x7f12, + 0x813f, 0x8310, 0x8516, 0x8d62, 0x9965, 0xa15e, 0xa86f, 0xb118, + 0xb30c, 0xb86d, 0xc10c, 0xc917, 0xd111, 0xd91e, 0xe10d, 0xe84e, + // Entry 100 - 13F + 0xf11d, 0xf525, 0xf924, 0x0123, 0x0926, 0x112a, 0x192d, 0x2023, + 0x2929, 0x312c, 0x3728, 0x3920, 0x3d2e, 0x4132, 0x4931, 0x4ec3, + 0x551a, 0x646c, 0x747c, 0x7e80, 0x80a0, 0x8299, 0x8530, 0x9136, + 0xa53e, 0xac37, 0xb537, 0xb938, 0xbd3c, 0xd941, 0xe543, 0xed5f, + 0xef5f, 0xf658, 0xfd63, 0x7c20, 0x7ef5, 0x80f6, 0x82f7, 0x84f8, + 0x86f9, 0x88fa, 0x8afb, 0x8cfc, 0x8e71, 0x90fe, 0x92ff, 0x9500, + 0x9701, 0x9902, 0x9b44, 0x9d45, 0x9f46, 0xa147, 0xa348, 0xa549, + 0xa74a, 0xa94b, 0xab4c, 0xad4d, 0xaf4e, 0xb14f, 0xb350, 0xb551, + // Entry 140 - 17F + 0xb752, 0xb953, 0xbb54, 0xbd55, 0xbf56, 0xc157, 0xc358, 0xc559, + 0xc75a, 0xc95b, 0xcb5c, 0xcd5d, 0xcf66, +} + +// Size: 2128 bytes +var variantIndex = map[string]uint8{ + "1606nict": 0x0, + "1694acad": 0x1, + "1901": 0x2, + "1959acad": 0x3, + "1994": 0x67, + "1996": 0x4, + "abl1943": 0x5, + "akuapem": 0x6, + "alalc97": 0x69, + "aluku": 0x7, + "ao1990": 0x8, + "aranes": 0x9, + "arevela": 0xa, + "arevmda": 0xb, + "arkaika": 0xc, + "asante": 0xd, + "auvern": 0xe, + "baku1926": 0xf, + "balanka": 0x10, + "barla": 0x11, + "basiceng": 0x12, + "bauddha": 0x13, + "bciav": 0x14, + "bcizbl": 0x15, + "biscayan": 0x16, + "biske": 0x62, + "bohoric": 0x17, + "boont": 0x18, + "bornholm": 0x19, + "cisaup": 0x1a, + "colb1945": 0x1b, + "cornu": 0x1c, + "creiss": 0x1d, + "dajnko": 0x1e, + "ekavsk": 0x1f, + "emodeng": 0x20, + "fonipa": 0x6a, + "fonkirsh": 0x6b, + "fonnapa": 0x6c, + "fonupa": 0x6d, + "fonxsamp": 0x6e, + "gallo": 0x21, + "gascon": 0x22, + "grclass": 0x23, + "grital": 0x24, + "grmistr": 0x25, + "hepburn": 0x26, + "heploc": 0x68, + "hognorsk": 0x27, + "hsistemo": 0x28, + "ijekavsk": 0x29, + "itihasa": 0x2a, + "ivanchov": 0x2b, + "jauer": 0x2c, + "jyutping": 0x2d, + "kkcor": 0x2e, + "kociewie": 0x2f, + "kscor": 0x30, + "laukika": 0x31, + "lemosin": 0x32, + "lengadoc": 0x33, + "lipaw": 0x63, + "ltg1929": 0x34, + "ltg2007": 0x35, + "luna1918": 0x36, + "metelko": 0x37, + "monoton": 0x38, + "ndyuka": 0x39, + "nedis": 0x3a, + "newfound": 0x3b, + "nicard": 0x3c, + "njiva": 0x64, + "nulik": 0x3d, + "osojs": 0x65, + "oxendict": 0x3e, + "pahawh2": 0x3f, + "pahawh3": 0x40, + "pahawh4": 0x41, + "pamaka": 0x42, + "peano": 0x43, + "petr1708": 0x44, + "pinyin": 0x45, + "polyton": 0x46, + "provenc": 0x47, + "puter": 0x48, + "rigik": 0x49, + "rozaj": 0x4a, + "rumgr": 0x4b, + "scotland": 0x4c, + "scouse": 0x4d, + "simple": 0x6f, + "solba": 0x66, + "sotav": 0x4e, + "spanglis": 0x4f, + "surmiran": 0x50, + "sursilv": 0x51, + "sutsilv": 0x52, + "synnejyl": 0x53, + "tarask": 0x54, + "tongyong": 0x55, + "tunumiit": 0x56, + "uccor": 0x57, + "ucrcor": 0x58, + "ulster": 0x59, + "unifon": 0x5a, + "vaidika": 0x5b, + "valencia": 0x5c, + "vallader": 0x5d, + "vecdruka": 0x5e, + "vivaraup": 0x5f, + "wadegile": 0x60, + "xsistemo": 0x61, +} + +// variantNumSpecialized is the number of specialized variants in variants. +const variantNumSpecialized = 105 + +// nRegionGroups is the number of region groups. +const nRegionGroups = 33 + +type likelyLangRegion struct { + lang uint16 + region uint16 +} + +// likelyScript is a lookup table, indexed by scriptID, for the most likely +// languages and regions given a script. +// Size: 1052 bytes, 263 elements +var likelyScript = [263]likelyLangRegion{ + 1: {lang: 0x14e, region: 0x85}, + 3: {lang: 0x2a2, region: 0x107}, + 4: {lang: 0x1f, region: 0x9a}, + 5: {lang: 0x3a, region: 0x6c}, + 7: {lang: 0x3b, region: 0x9d}, + 8: {lang: 0x1d7, region: 0x28}, + 9: {lang: 0x13, region: 0x9d}, + 10: {lang: 0x5b, region: 0x96}, + 11: {lang: 0x60, region: 0x52}, + 12: {lang: 0xb9, region: 0xb5}, + 13: {lang: 0x63, region: 0x96}, + 14: {lang: 0xa5, region: 0x35}, + 15: {lang: 0x3e9, region: 0x9a}, + 17: {lang: 0x529, region: 0x12f}, + 18: {lang: 0x3b1, region: 0x9a}, + 19: {lang: 0x15e, region: 0x79}, + 20: {lang: 0xc2, region: 0x96}, + 21: {lang: 0x9d, region: 0xe8}, + 22: {lang: 0xdb, region: 0x35}, + 23: {lang: 0xf3, region: 0x49}, + 24: {lang: 0x4f0, region: 0x12c}, + 25: {lang: 0xe7, region: 0x13f}, + 26: {lang: 0xe5, region: 0x136}, + 29: {lang: 0xf1, region: 0x6c}, + 31: {lang: 0x1a0, region: 0x5e}, + 32: {lang: 0x3e2, region: 0x107}, + 34: {lang: 0x1be, region: 0x9a}, + 38: {lang: 0x15e, region: 0x79}, + 41: {lang: 0x133, region: 0x6c}, + 42: {lang: 0x431, region: 0x27}, + 44: {lang: 0x27, region: 0x70}, + 46: {lang: 0x210, region: 0x7e}, + 47: {lang: 0xfe, region: 0x38}, + 49: {lang: 0x19b, region: 0x9a}, + 50: {lang: 0x19e, region: 0x131}, + 51: {lang: 0x3e9, region: 0x9a}, + 52: {lang: 0x136, region: 0x88}, + 53: {lang: 0x1a4, region: 0x9a}, + 54: {lang: 0x39d, region: 0x9a}, + 55: {lang: 0x529, region: 0x12f}, + 56: {lang: 0x254, region: 0xac}, + 57: {lang: 0x529, region: 0x53}, + 58: {lang: 0x1cb, region: 0xe8}, + 59: {lang: 0x529, region: 0x53}, + 60: {lang: 0x529, region: 0x12f}, + 61: {lang: 0x2fd, region: 0x9c}, + 62: {lang: 0x1bc, region: 0x98}, + 63: {lang: 0x200, region: 0xa3}, + 64: {lang: 0x1c5, region: 0x12c}, + 65: {lang: 0x1ca, region: 0xb0}, + 68: {lang: 0x1d5, region: 0x93}, + 70: {lang: 0x142, region: 0x9f}, + 71: {lang: 0x254, region: 0xac}, + 72: {lang: 0x20e, region: 0x96}, + 73: {lang: 0x200, region: 0xa3}, + 75: {lang: 0x135, region: 0xc5}, + 76: {lang: 0x200, region: 0xa3}, + 78: {lang: 0x3bb, region: 0xe9}, + 79: {lang: 0x24a, region: 0xa7}, + 80: {lang: 0x3fa, region: 0x9a}, + 83: {lang: 0x251, region: 0x9a}, + 84: {lang: 0x254, region: 0xac}, + 86: {lang: 0x88, region: 0x9a}, + 87: {lang: 0x370, region: 0x124}, + 88: {lang: 0x2b8, region: 0xb0}, + 93: {lang: 0x29f, region: 0x9a}, + 94: {lang: 0x2a8, region: 0x9a}, + 95: {lang: 0x28f, region: 0x88}, + 96: {lang: 0x1a0, region: 0x88}, + 97: {lang: 0x2ac, region: 0x53}, + 99: {lang: 0x4f4, region: 0x12c}, + 100: {lang: 0x4f5, region: 0x12c}, + 101: {lang: 0x1be, region: 0x9a}, + 103: {lang: 0x337, region: 0x9d}, + 104: {lang: 0x4f7, region: 0x53}, + 105: {lang: 0xa9, region: 0x53}, + 108: {lang: 0x2e8, region: 0x113}, + 109: {lang: 0x4f8, region: 0x10c}, + 110: {lang: 0x4f8, region: 0x10c}, + 111: {lang: 0x304, region: 0x9a}, + 112: {lang: 0x31b, region: 0x9a}, + 113: {lang: 0x30b, region: 0x53}, + 115: {lang: 0x31e, region: 0x35}, + 116: {lang: 0x30e, region: 0x9a}, + 117: {lang: 0x414, region: 0xe9}, + 118: {lang: 0x331, region: 0xc5}, + 121: {lang: 0x4f9, region: 0x109}, + 122: {lang: 0x3b, region: 0xa2}, + 123: {lang: 0x353, region: 0xdc}, + 126: {lang: 0x2d0, region: 0x85}, + 127: {lang: 0x52a, region: 0x53}, + 128: {lang: 0x403, region: 0x97}, + 129: {lang: 0x3ee, region: 0x9a}, + 130: {lang: 0x39b, region: 0xc6}, + 131: {lang: 0x395, region: 0x9a}, + 132: {lang: 0x399, region: 0x136}, + 133: {lang: 0x429, region: 0x116}, + 135: {lang: 0x3b, region: 0x11d}, + 136: {lang: 0xfd, region: 0xc5}, + 139: {lang: 0x27d, region: 0x107}, + 140: {lang: 0x2c9, region: 0x53}, + 141: {lang: 0x39f, region: 0x9d}, + 142: {lang: 0x39f, region: 0x53}, + 144: {lang: 0x3ad, region: 0xb1}, + 146: {lang: 0x1c6, region: 0x53}, + 147: {lang: 0x4fd, region: 0x9d}, + 200: {lang: 0x3cb, region: 0x96}, + 203: {lang: 0x372, region: 0x10d}, + 204: {lang: 0x420, region: 0x98}, + 206: {lang: 0x4ff, region: 0x15f}, + 207: {lang: 0x3f0, region: 0x9a}, + 208: {lang: 0x45, region: 0x136}, + 209: {lang: 0x139, region: 0x7c}, + 210: {lang: 0x3e9, region: 0x9a}, + 212: {lang: 0x3e9, region: 0x9a}, + 213: {lang: 0x3fa, region: 0x9a}, + 214: {lang: 0x40c, region: 0xb4}, + 217: {lang: 0x433, region: 0x9a}, + 218: {lang: 0xef, region: 0xc6}, + 219: {lang: 0x43e, region: 0x96}, + 221: {lang: 0x44d, region: 0x35}, + 222: {lang: 0x44e, region: 0x9c}, + 226: {lang: 0x45a, region: 0xe8}, + 227: {lang: 0x11a, region: 0x9a}, + 228: {lang: 0x45e, region: 0x53}, + 229: {lang: 0x232, region: 0x53}, + 230: {lang: 0x450, region: 0x9a}, + 231: {lang: 0x4a5, region: 0x53}, + 232: {lang: 0x9f, region: 0x13f}, + 233: {lang: 0x461, region: 0x9a}, + 235: {lang: 0x528, region: 0xbb}, + 236: {lang: 0x153, region: 0xe8}, + 237: {lang: 0x128, region: 0xce}, + 238: {lang: 0x46b, region: 0x124}, + 239: {lang: 0xa9, region: 0x53}, + 240: {lang: 0x2ce, region: 0x9a}, + 243: {lang: 0x4ad, region: 0x11d}, + 244: {lang: 0x4be, region: 0xb5}, + 247: {lang: 0x1ce, region: 0x9a}, + 250: {lang: 0x3a9, region: 0x9d}, + 251: {lang: 0x22, region: 0x9c}, + 253: {lang: 0x1ea, region: 0x53}, + 254: {lang: 0xef, region: 0xc6}, +} + +type likelyScriptRegion struct { + region uint16 + script uint16 + flags uint8 +} + +// likelyLang is a lookup table, indexed by langID, for the most likely +// scripts and regions given incomplete information. If more entries exist for a +// given language, region and script are the index and size respectively +// of the list in likelyLangList. +// Size: 7980 bytes, 1330 elements +var likelyLang = [1330]likelyScriptRegion{ + 0: {region: 0x136, script: 0x5b, flags: 0x0}, + 1: {region: 0x70, script: 0x5b, flags: 0x0}, + 2: {region: 0x166, script: 0x5b, flags: 0x0}, + 3: {region: 0x166, script: 0x5b, flags: 0x0}, + 4: {region: 0x166, script: 0x5b, flags: 0x0}, + 5: {region: 0x7e, script: 0x20, flags: 0x0}, + 6: {region: 0x166, script: 0x5b, flags: 0x0}, + 7: {region: 0x166, script: 0x20, flags: 0x0}, + 8: {region: 0x81, script: 0x5b, flags: 0x0}, + 9: {region: 0x166, script: 0x5b, flags: 0x0}, + 10: {region: 0x166, script: 0x5b, flags: 0x0}, + 11: {region: 0x166, script: 0x5b, flags: 0x0}, + 12: {region: 0x96, script: 0x5b, flags: 0x0}, + 13: {region: 0x132, script: 0x5b, flags: 0x0}, + 14: {region: 0x81, script: 0x5b, flags: 0x0}, + 15: {region: 0x166, script: 0x5b, flags: 0x0}, + 16: {region: 0x166, script: 0x5b, flags: 0x0}, + 17: {region: 0x107, script: 0x20, flags: 0x0}, + 18: {region: 0x166, script: 0x5b, flags: 0x0}, + 19: {region: 0x9d, script: 0x9, flags: 0x0}, + 20: {region: 0x129, script: 0x5, flags: 0x0}, + 21: {region: 0x166, script: 0x5b, flags: 0x0}, + 22: {region: 0x162, script: 0x5b, flags: 0x0}, + 23: {region: 0x166, script: 0x5b, flags: 0x0}, + 24: {region: 0x166, script: 0x5b, flags: 0x0}, + 25: {region: 0x166, script: 0x5b, flags: 0x0}, + 26: {region: 0x166, script: 0x5b, flags: 0x0}, + 27: {region: 0x166, script: 0x5b, flags: 0x0}, + 28: {region: 0x52, script: 0x5b, flags: 0x0}, + 29: {region: 0x166, script: 0x5b, flags: 0x0}, + 30: {region: 0x166, script: 0x5b, flags: 0x0}, + 31: {region: 0x9a, script: 0x4, flags: 0x0}, + 32: {region: 0x166, script: 0x5b, flags: 0x0}, + 33: {region: 0x81, script: 0x5b, flags: 0x0}, + 34: {region: 0x9c, script: 0xfb, flags: 0x0}, + 35: {region: 0x166, script: 0x5b, flags: 0x0}, + 36: {region: 0x166, script: 0x5b, flags: 0x0}, + 37: {region: 0x14e, script: 0x5b, flags: 0x0}, + 38: {region: 0x107, script: 0x20, flags: 0x0}, + 39: {region: 0x70, script: 0x2c, flags: 0x0}, + 40: {region: 0x166, script: 0x5b, flags: 0x0}, + 41: {region: 0x166, script: 0x5b, flags: 0x0}, + 42: {region: 0xd7, script: 0x5b, flags: 0x0}, + 43: {region: 0x166, script: 0x5b, flags: 0x0}, + 45: {region: 0x166, script: 0x5b, flags: 0x0}, + 46: {region: 0x166, script: 0x5b, flags: 0x0}, + 47: {region: 0x166, script: 0x5b, flags: 0x0}, + 48: {region: 0x166, script: 0x5b, flags: 0x0}, + 49: {region: 0x166, script: 0x5b, flags: 0x0}, + 50: {region: 0x166, script: 0x5b, flags: 0x0}, + 51: {region: 0x96, script: 0x5b, flags: 0x0}, + 52: {region: 0x166, script: 0x5, flags: 0x0}, + 53: {region: 0x123, script: 0x5, flags: 0x0}, + 54: {region: 0x166, script: 0x5b, flags: 0x0}, + 55: {region: 0x166, script: 0x5b, flags: 0x0}, + 56: {region: 0x166, script: 0x5b, flags: 0x0}, + 57: {region: 0x166, script: 0x5b, flags: 0x0}, + 58: {region: 0x6c, script: 0x5, flags: 0x0}, + 59: {region: 0x0, script: 0x3, flags: 0x1}, + 60: {region: 0x166, script: 0x5b, flags: 0x0}, + 61: {region: 0x51, script: 0x5b, flags: 0x0}, + 62: {region: 0x3f, script: 0x5b, flags: 0x0}, + 63: {region: 0x68, script: 0x5, flags: 0x0}, + 65: {region: 0xbb, script: 0x5, flags: 0x0}, + 66: {region: 0x6c, script: 0x5, flags: 0x0}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0x130, script: 0x5b, flags: 0x0}, + 69: {region: 0x136, script: 0xd0, flags: 0x0}, + 70: {region: 0x166, script: 0x5b, flags: 0x0}, + 71: {region: 0x166, script: 0x5b, flags: 0x0}, + 72: {region: 0x6f, script: 0x5b, flags: 0x0}, + 73: {region: 0x166, script: 0x5b, flags: 0x0}, + 74: {region: 0x166, script: 0x5b, flags: 0x0}, + 75: {region: 0x49, script: 0x5b, flags: 0x0}, + 76: {region: 0x166, script: 0x5b, flags: 0x0}, + 77: {region: 0x107, script: 0x20, flags: 0x0}, + 78: {region: 0x166, script: 0x5, flags: 0x0}, + 79: {region: 0x166, script: 0x5b, flags: 0x0}, + 80: {region: 0x166, script: 0x5b, flags: 0x0}, + 81: {region: 0x166, script: 0x5b, flags: 0x0}, + 82: {region: 0x9a, script: 0x22, flags: 0x0}, + 83: {region: 0x166, script: 0x5b, flags: 0x0}, + 84: {region: 0x166, script: 0x5b, flags: 0x0}, + 85: {region: 0x166, script: 0x5b, flags: 0x0}, + 86: {region: 0x3f, script: 0x5b, flags: 0x0}, + 87: {region: 0x166, script: 0x5b, flags: 0x0}, + 88: {region: 0x3, script: 0x5, flags: 0x1}, + 89: {region: 0x107, script: 0x20, flags: 0x0}, + 90: {region: 0xe9, script: 0x5, flags: 0x0}, + 91: {region: 0x96, script: 0x5b, flags: 0x0}, + 92: {region: 0xdc, script: 0x22, flags: 0x0}, + 93: {region: 0x2e, script: 0x5b, flags: 0x0}, + 94: {region: 0x52, script: 0x5b, flags: 0x0}, + 95: {region: 0x166, script: 0x5b, flags: 0x0}, + 96: {region: 0x52, script: 0xb, flags: 0x0}, + 97: {region: 0x166, script: 0x5b, flags: 0x0}, + 98: {region: 0x166, script: 0x5b, flags: 0x0}, + 99: {region: 0x96, script: 0x5b, flags: 0x0}, + 100: {region: 0x166, script: 0x5b, flags: 0x0}, + 101: {region: 0x52, script: 0x5b, flags: 0x0}, + 102: {region: 0x166, script: 0x5b, flags: 0x0}, + 103: {region: 0x166, script: 0x5b, flags: 0x0}, + 104: {region: 0x166, script: 0x5b, flags: 0x0}, + 105: {region: 0x166, script: 0x5b, flags: 0x0}, + 106: {region: 0x4f, script: 0x5b, flags: 0x0}, + 107: {region: 0x166, script: 0x5b, flags: 0x0}, + 108: {region: 0x166, script: 0x5b, flags: 0x0}, + 109: {region: 0x166, script: 0x5b, flags: 0x0}, + 110: {region: 0x166, script: 0x2c, flags: 0x0}, + 111: {region: 0x166, script: 0x5b, flags: 0x0}, + 112: {region: 0x166, script: 0x5b, flags: 0x0}, + 113: {region: 0x47, script: 0x20, flags: 0x0}, + 114: {region: 0x166, script: 0x5b, flags: 0x0}, + 115: {region: 0x166, script: 0x5b, flags: 0x0}, + 116: {region: 0x10c, script: 0x5, flags: 0x0}, + 117: {region: 0x163, script: 0x5b, flags: 0x0}, + 118: {region: 0x166, script: 0x5b, flags: 0x0}, + 119: {region: 0x96, script: 0x5b, flags: 0x0}, + 120: {region: 0x166, script: 0x5b, flags: 0x0}, + 121: {region: 0x130, script: 0x5b, flags: 0x0}, + 122: {region: 0x52, script: 0x5b, flags: 0x0}, + 123: {region: 0x9a, script: 0xe6, flags: 0x0}, + 124: {region: 0xe9, script: 0x5, flags: 0x0}, + 125: {region: 0x9a, script: 0x22, flags: 0x0}, + 126: {region: 0x38, script: 0x20, flags: 0x0}, + 127: {region: 0x9a, script: 0x22, flags: 0x0}, + 128: {region: 0xe9, script: 0x5, flags: 0x0}, + 129: {region: 0x12c, script: 0x34, flags: 0x0}, + 131: {region: 0x9a, script: 0x22, flags: 0x0}, + 132: {region: 0x166, script: 0x5b, flags: 0x0}, + 133: {region: 0x9a, script: 0x22, flags: 0x0}, + 134: {region: 0xe8, script: 0x5b, flags: 0x0}, + 135: {region: 0x166, script: 0x5b, flags: 0x0}, + 136: {region: 0x9a, script: 0x22, flags: 0x0}, + 137: {region: 0x166, script: 0x5b, flags: 0x0}, + 138: {region: 0x140, script: 0x5b, flags: 0x0}, + 139: {region: 0x166, script: 0x5b, flags: 0x0}, + 140: {region: 0x166, script: 0x5b, flags: 0x0}, + 141: {region: 0xe8, script: 0x5b, flags: 0x0}, + 142: {region: 0x166, script: 0x5b, flags: 0x0}, + 143: {region: 0xd7, script: 0x5b, flags: 0x0}, + 144: {region: 0x166, script: 0x5b, flags: 0x0}, + 145: {region: 0x166, script: 0x5b, flags: 0x0}, + 146: {region: 0x166, script: 0x5b, flags: 0x0}, + 147: {region: 0x166, script: 0x2c, flags: 0x0}, + 148: {region: 0x9a, script: 0x22, flags: 0x0}, + 149: {region: 0x96, script: 0x5b, flags: 0x0}, + 150: {region: 0x166, script: 0x5b, flags: 0x0}, + 151: {region: 0x166, script: 0x5b, flags: 0x0}, + 152: {region: 0x115, script: 0x5b, flags: 0x0}, + 153: {region: 0x166, script: 0x5b, flags: 0x0}, + 154: {region: 0x166, script: 0x5b, flags: 0x0}, + 155: {region: 0x52, script: 0x5b, flags: 0x0}, + 156: {region: 0x166, script: 0x5b, flags: 0x0}, + 157: {region: 0xe8, script: 0x5b, flags: 0x0}, + 158: {region: 0x166, script: 0x5b, flags: 0x0}, + 159: {region: 0x13f, script: 0xe8, flags: 0x0}, + 160: {region: 0xc4, script: 0x5b, flags: 0x0}, + 161: {region: 0x166, script: 0x5b, flags: 0x0}, + 162: {region: 0x166, script: 0x5b, flags: 0x0}, + 163: {region: 0xc4, script: 0x5b, flags: 0x0}, + 164: {region: 0x166, script: 0x5b, flags: 0x0}, + 165: {region: 0x35, script: 0xe, flags: 0x0}, + 166: {region: 0x166, script: 0x5b, flags: 0x0}, + 167: {region: 0x166, script: 0x5b, flags: 0x0}, + 168: {region: 0x166, script: 0x5b, flags: 0x0}, + 169: {region: 0x53, script: 0xef, flags: 0x0}, + 170: {region: 0x166, script: 0x5b, flags: 0x0}, + 171: {region: 0x166, script: 0x5b, flags: 0x0}, + 172: {region: 0x166, script: 0x5b, flags: 0x0}, + 173: {region: 0x9a, script: 0xe, flags: 0x0}, + 174: {region: 0x166, script: 0x5b, flags: 0x0}, + 175: {region: 0x9d, script: 0x5, flags: 0x0}, + 176: {region: 0x166, script: 0x5b, flags: 0x0}, + 177: {region: 0x4f, script: 0x5b, flags: 0x0}, + 178: {region: 0x79, script: 0x5b, flags: 0x0}, + 179: {region: 0x9a, script: 0x22, flags: 0x0}, + 180: {region: 0xe9, script: 0x5, flags: 0x0}, + 181: {region: 0x9a, script: 0x22, flags: 0x0}, + 182: {region: 0x166, script: 0x5b, flags: 0x0}, + 183: {region: 0x33, script: 0x5b, flags: 0x0}, + 184: {region: 0x166, script: 0x5b, flags: 0x0}, + 185: {region: 0xb5, script: 0xc, flags: 0x0}, + 186: {region: 0x52, script: 0x5b, flags: 0x0}, + 187: {region: 0x166, script: 0x2c, flags: 0x0}, + 188: {region: 0xe8, script: 0x5b, flags: 0x0}, + 189: {region: 0x166, script: 0x5b, flags: 0x0}, + 190: {region: 0xe9, script: 0x22, flags: 0x0}, + 191: {region: 0x107, script: 0x20, flags: 0x0}, + 192: {region: 0x160, script: 0x5b, flags: 0x0}, + 193: {region: 0x166, script: 0x5b, flags: 0x0}, + 194: {region: 0x96, script: 0x5b, flags: 0x0}, + 195: {region: 0x166, script: 0x5b, flags: 0x0}, + 196: {region: 0x52, script: 0x5b, flags: 0x0}, + 197: {region: 0x166, script: 0x5b, flags: 0x0}, + 198: {region: 0x166, script: 0x5b, flags: 0x0}, + 199: {region: 0x166, script: 0x5b, flags: 0x0}, + 200: {region: 0x87, script: 0x5b, flags: 0x0}, + 201: {region: 0x166, script: 0x5b, flags: 0x0}, + 202: {region: 0x166, script: 0x5b, flags: 0x0}, + 203: {region: 0x166, script: 0x5b, flags: 0x0}, + 204: {region: 0x166, script: 0x5b, flags: 0x0}, + 205: {region: 0x6e, script: 0x2c, flags: 0x0}, + 206: {region: 0x166, script: 0x5b, flags: 0x0}, + 207: {region: 0x166, script: 0x5b, flags: 0x0}, + 208: {region: 0x52, script: 0x5b, flags: 0x0}, + 209: {region: 0x166, script: 0x5b, flags: 0x0}, + 210: {region: 0x166, script: 0x5b, flags: 0x0}, + 211: {region: 0xc4, script: 0x5b, flags: 0x0}, + 212: {region: 0x166, script: 0x5b, flags: 0x0}, + 213: {region: 0x166, script: 0x5b, flags: 0x0}, + 214: {region: 0x166, script: 0x5b, flags: 0x0}, + 215: {region: 0x6f, script: 0x5b, flags: 0x0}, + 216: {region: 0x166, script: 0x5b, flags: 0x0}, + 217: {region: 0x166, script: 0x5b, flags: 0x0}, + 218: {region: 0xd7, script: 0x5b, flags: 0x0}, + 219: {region: 0x35, script: 0x16, flags: 0x0}, + 220: {region: 0x107, script: 0x20, flags: 0x0}, + 221: {region: 0xe8, script: 0x5b, flags: 0x0}, + 222: {region: 0x166, script: 0x5b, flags: 0x0}, + 223: {region: 0x132, script: 0x5b, flags: 0x0}, + 224: {region: 0x8b, script: 0x5b, flags: 0x0}, + 225: {region: 0x76, script: 0x5b, flags: 0x0}, + 226: {region: 0x107, script: 0x20, flags: 0x0}, + 227: {region: 0x136, script: 0x5b, flags: 0x0}, + 228: {region: 0x49, script: 0x5b, flags: 0x0}, + 229: {region: 0x136, script: 0x1a, flags: 0x0}, + 230: {region: 0xa7, script: 0x5, flags: 0x0}, + 231: {region: 0x13f, script: 0x19, flags: 0x0}, + 232: {region: 0x166, script: 0x5b, flags: 0x0}, + 233: {region: 0x9c, script: 0x5, flags: 0x0}, + 234: {region: 0x166, script: 0x5b, flags: 0x0}, + 235: {region: 0x166, script: 0x5b, flags: 0x0}, + 236: {region: 0x166, script: 0x5b, flags: 0x0}, + 237: {region: 0x166, script: 0x5b, flags: 0x0}, + 238: {region: 0x166, script: 0x5b, flags: 0x0}, + 239: {region: 0xc6, script: 0xda, flags: 0x0}, + 240: {region: 0x79, script: 0x5b, flags: 0x0}, + 241: {region: 0x6c, script: 0x1d, flags: 0x0}, + 242: {region: 0xe8, script: 0x5b, flags: 0x0}, + 243: {region: 0x49, script: 0x17, flags: 0x0}, + 244: {region: 0x131, script: 0x20, flags: 0x0}, + 245: {region: 0x49, script: 0x17, flags: 0x0}, + 246: {region: 0x49, script: 0x17, flags: 0x0}, + 247: {region: 0x49, script: 0x17, flags: 0x0}, + 248: {region: 0x49, script: 0x17, flags: 0x0}, + 249: {region: 0x10b, script: 0x5b, flags: 0x0}, + 250: {region: 0x5f, script: 0x5b, flags: 0x0}, + 251: {region: 0xea, script: 0x5b, flags: 0x0}, + 252: {region: 0x49, script: 0x17, flags: 0x0}, + 253: {region: 0xc5, script: 0x88, flags: 0x0}, + 254: {region: 0x8, script: 0x2, flags: 0x1}, + 255: {region: 0x107, script: 0x20, flags: 0x0}, + 256: {region: 0x7c, script: 0x5b, flags: 0x0}, + 257: {region: 0x64, script: 0x5b, flags: 0x0}, + 258: {region: 0x166, script: 0x5b, flags: 0x0}, + 259: {region: 0x166, script: 0x5b, flags: 0x0}, + 260: {region: 0x166, script: 0x5b, flags: 0x0}, + 261: {region: 0x166, script: 0x5b, flags: 0x0}, + 262: {region: 0x136, script: 0x5b, flags: 0x0}, + 263: {region: 0x107, script: 0x20, flags: 0x0}, + 264: {region: 0xa5, script: 0x5b, flags: 0x0}, + 265: {region: 0x166, script: 0x5b, flags: 0x0}, + 266: {region: 0x166, script: 0x5b, flags: 0x0}, + 267: {region: 0x9a, script: 0x5, flags: 0x0}, + 268: {region: 0x166, script: 0x5b, flags: 0x0}, + 269: {region: 0x61, script: 0x5b, flags: 0x0}, + 270: {region: 0x166, script: 0x5b, flags: 0x0}, + 271: {region: 0x49, script: 0x5b, flags: 0x0}, + 272: {region: 0x166, script: 0x5b, flags: 0x0}, + 273: {region: 0x166, script: 0x5b, flags: 0x0}, + 274: {region: 0x166, script: 0x5b, flags: 0x0}, + 275: {region: 0x166, script: 0x5, flags: 0x0}, + 276: {region: 0x49, script: 0x5b, flags: 0x0}, + 277: {region: 0x166, script: 0x5b, flags: 0x0}, + 278: {region: 0x166, script: 0x5b, flags: 0x0}, + 279: {region: 0xd5, script: 0x5b, flags: 0x0}, + 280: {region: 0x4f, script: 0x5b, flags: 0x0}, + 281: {region: 0x166, script: 0x5b, flags: 0x0}, + 282: {region: 0x9a, script: 0x5, flags: 0x0}, + 283: {region: 0x166, script: 0x5b, flags: 0x0}, + 284: {region: 0x166, script: 0x5b, flags: 0x0}, + 285: {region: 0x166, script: 0x5b, flags: 0x0}, + 286: {region: 0x166, script: 0x2c, flags: 0x0}, + 287: {region: 0x61, script: 0x5b, flags: 0x0}, + 288: {region: 0xc4, script: 0x5b, flags: 0x0}, + 289: {region: 0xd1, script: 0x5b, flags: 0x0}, + 290: {region: 0x166, script: 0x5b, flags: 0x0}, + 291: {region: 0xdc, script: 0x22, flags: 0x0}, + 292: {region: 0x52, script: 0x5b, flags: 0x0}, + 293: {region: 0x166, script: 0x5b, flags: 0x0}, + 294: {region: 0x166, script: 0x5b, flags: 0x0}, + 295: {region: 0x166, script: 0x5b, flags: 0x0}, + 296: {region: 0xce, script: 0xed, flags: 0x0}, + 297: {region: 0x166, script: 0x5b, flags: 0x0}, + 298: {region: 0x166, script: 0x5b, flags: 0x0}, + 299: {region: 0x115, script: 0x5b, flags: 0x0}, + 300: {region: 0x37, script: 0x5b, flags: 0x0}, + 301: {region: 0x43, script: 0xef, flags: 0x0}, + 302: {region: 0x166, script: 0x5b, flags: 0x0}, + 303: {region: 0xa5, script: 0x5b, flags: 0x0}, + 304: {region: 0x81, script: 0x5b, flags: 0x0}, + 305: {region: 0xd7, script: 0x5b, flags: 0x0}, + 306: {region: 0x9f, script: 0x5b, flags: 0x0}, + 307: {region: 0x6c, script: 0x29, flags: 0x0}, + 308: {region: 0x166, script: 0x5b, flags: 0x0}, + 309: {region: 0xc5, script: 0x4b, flags: 0x0}, + 310: {region: 0x88, script: 0x34, flags: 0x0}, + 311: {region: 0x166, script: 0x5b, flags: 0x0}, + 312: {region: 0x166, script: 0x5b, flags: 0x0}, + 313: {region: 0xa, script: 0x2, flags: 0x1}, + 314: {region: 0x166, script: 0x5b, flags: 0x0}, + 315: {region: 0x166, script: 0x5b, flags: 0x0}, + 316: {region: 0x1, script: 0x5b, flags: 0x0}, + 317: {region: 0x166, script: 0x5b, flags: 0x0}, + 318: {region: 0x6f, script: 0x5b, flags: 0x0}, + 319: {region: 0x136, script: 0x5b, flags: 0x0}, + 320: {region: 0x6b, script: 0x5b, flags: 0x0}, + 321: {region: 0x166, script: 0x5b, flags: 0x0}, + 322: {region: 0x9f, script: 0x46, flags: 0x0}, + 323: {region: 0x166, script: 0x5b, flags: 0x0}, + 324: {region: 0x166, script: 0x5b, flags: 0x0}, + 325: {region: 0x6f, script: 0x5b, flags: 0x0}, + 326: {region: 0x52, script: 0x5b, flags: 0x0}, + 327: {region: 0x6f, script: 0x5b, flags: 0x0}, + 328: {region: 0x9d, script: 0x5, flags: 0x0}, + 329: {region: 0x166, script: 0x5b, flags: 0x0}, + 330: {region: 0x166, script: 0x5b, flags: 0x0}, + 331: {region: 0x166, script: 0x5b, flags: 0x0}, + 332: {region: 0x166, script: 0x5b, flags: 0x0}, + 333: {region: 0x87, script: 0x5b, flags: 0x0}, + 334: {region: 0xc, script: 0x2, flags: 0x1}, + 335: {region: 0x166, script: 0x5b, flags: 0x0}, + 336: {region: 0xc4, script: 0x5b, flags: 0x0}, + 337: {region: 0x73, script: 0x5b, flags: 0x0}, + 338: {region: 0x10c, script: 0x5, flags: 0x0}, + 339: {region: 0xe8, script: 0x5b, flags: 0x0}, + 340: {region: 0x10d, script: 0x5b, flags: 0x0}, + 341: {region: 0x74, script: 0x5b, flags: 0x0}, + 342: {region: 0x166, script: 0x5b, flags: 0x0}, + 343: {region: 0x166, script: 0x5b, flags: 0x0}, + 344: {region: 0x77, script: 0x5b, flags: 0x0}, + 345: {region: 0x166, script: 0x5b, flags: 0x0}, + 346: {region: 0x3b, script: 0x5b, flags: 0x0}, + 347: {region: 0x166, script: 0x5b, flags: 0x0}, + 348: {region: 0x166, script: 0x5b, flags: 0x0}, + 349: {region: 0x166, script: 0x5b, flags: 0x0}, + 350: {region: 0x79, script: 0x5b, flags: 0x0}, + 351: {region: 0x136, script: 0x5b, flags: 0x0}, + 352: {region: 0x79, script: 0x5b, flags: 0x0}, + 353: {region: 0x61, script: 0x5b, flags: 0x0}, + 354: {region: 0x61, script: 0x5b, flags: 0x0}, + 355: {region: 0x52, script: 0x5, flags: 0x0}, + 356: {region: 0x141, script: 0x5b, flags: 0x0}, + 357: {region: 0x166, script: 0x5b, flags: 0x0}, + 358: {region: 0x85, script: 0x5b, flags: 0x0}, + 359: {region: 0x166, script: 0x5b, flags: 0x0}, + 360: {region: 0xd5, script: 0x5b, flags: 0x0}, + 361: {region: 0x9f, script: 0x5b, flags: 0x0}, + 362: {region: 0xd7, script: 0x5b, flags: 0x0}, + 363: {region: 0x166, script: 0x5b, flags: 0x0}, + 364: {region: 0x10c, script: 0x5b, flags: 0x0}, + 365: {region: 0xda, script: 0x5b, flags: 0x0}, + 366: {region: 0x97, script: 0x5b, flags: 0x0}, + 367: {region: 0x81, script: 0x5b, flags: 0x0}, + 368: {region: 0x166, script: 0x5b, flags: 0x0}, + 369: {region: 0xbd, script: 0x5b, flags: 0x0}, + 370: {region: 0x166, script: 0x5b, flags: 0x0}, + 371: {region: 0x166, script: 0x5b, flags: 0x0}, + 372: {region: 0x166, script: 0x5b, flags: 0x0}, + 373: {region: 0x53, script: 0x3b, flags: 0x0}, + 374: {region: 0x166, script: 0x5b, flags: 0x0}, + 375: {region: 0x96, script: 0x5b, flags: 0x0}, + 376: {region: 0x166, script: 0x5b, flags: 0x0}, + 377: {region: 0x166, script: 0x5b, flags: 0x0}, + 378: {region: 0x9a, script: 0x22, flags: 0x0}, + 379: {region: 0x166, script: 0x5b, flags: 0x0}, + 380: {region: 0x9d, script: 0x5, flags: 0x0}, + 381: {region: 0x7f, script: 0x5b, flags: 0x0}, + 382: {region: 0x7c, script: 0x5b, flags: 0x0}, + 383: {region: 0x166, script: 0x5b, flags: 0x0}, + 384: {region: 0x166, script: 0x5b, flags: 0x0}, + 385: {region: 0x166, script: 0x5b, flags: 0x0}, + 386: {region: 0x166, script: 0x5b, flags: 0x0}, + 387: {region: 0x166, script: 0x5b, flags: 0x0}, + 388: {region: 0x166, script: 0x5b, flags: 0x0}, + 389: {region: 0x70, script: 0x2c, flags: 0x0}, + 390: {region: 0x166, script: 0x5b, flags: 0x0}, + 391: {region: 0xdc, script: 0x22, flags: 0x0}, + 392: {region: 0x166, script: 0x5b, flags: 0x0}, + 393: {region: 0xa8, script: 0x5b, flags: 0x0}, + 394: {region: 0x166, script: 0x5b, flags: 0x0}, + 395: {region: 0xe9, script: 0x5, flags: 0x0}, + 396: {region: 0x166, script: 0x5b, flags: 0x0}, + 397: {region: 0xe9, script: 0x5, flags: 0x0}, + 398: {region: 0x166, script: 0x5b, flags: 0x0}, + 399: {region: 0x166, script: 0x5b, flags: 0x0}, + 400: {region: 0x6f, script: 0x5b, flags: 0x0}, + 401: {region: 0x9d, script: 0x5, flags: 0x0}, + 402: {region: 0x166, script: 0x5b, flags: 0x0}, + 403: {region: 0x166, script: 0x2c, flags: 0x0}, + 404: {region: 0xf2, script: 0x5b, flags: 0x0}, + 405: {region: 0x166, script: 0x5b, flags: 0x0}, + 406: {region: 0x166, script: 0x5b, flags: 0x0}, + 407: {region: 0x166, script: 0x5b, flags: 0x0}, + 408: {region: 0x166, script: 0x2c, flags: 0x0}, + 409: {region: 0x166, script: 0x5b, flags: 0x0}, + 410: {region: 0x9a, script: 0x22, flags: 0x0}, + 411: {region: 0x9a, script: 0xe9, flags: 0x0}, + 412: {region: 0x96, script: 0x5b, flags: 0x0}, + 413: {region: 0xda, script: 0x5b, flags: 0x0}, + 414: {region: 0x131, script: 0x32, flags: 0x0}, + 415: {region: 0x166, script: 0x5b, flags: 0x0}, + 416: {region: 0xe, script: 0x2, flags: 0x1}, + 417: {region: 0x9a, script: 0xe, flags: 0x0}, + 418: {region: 0x166, script: 0x5b, flags: 0x0}, + 419: {region: 0x4e, script: 0x5b, flags: 0x0}, + 420: {region: 0x9a, script: 0x35, flags: 0x0}, + 421: {region: 0x41, script: 0x5b, flags: 0x0}, + 422: {region: 0x54, script: 0x5b, flags: 0x0}, + 423: {region: 0x166, script: 0x5b, flags: 0x0}, + 424: {region: 0x81, script: 0x5b, flags: 0x0}, + 425: {region: 0x166, script: 0x5b, flags: 0x0}, + 426: {region: 0x166, script: 0x5b, flags: 0x0}, + 427: {region: 0xa5, script: 0x5b, flags: 0x0}, + 428: {region: 0x99, script: 0x5b, flags: 0x0}, + 429: {region: 0x166, script: 0x5b, flags: 0x0}, + 430: {region: 0xdc, script: 0x22, flags: 0x0}, + 431: {region: 0x166, script: 0x5b, flags: 0x0}, + 432: {region: 0x166, script: 0x5, flags: 0x0}, + 433: {region: 0x49, script: 0x5b, flags: 0x0}, + 434: {region: 0x166, script: 0x5, flags: 0x0}, + 435: {region: 0x166, script: 0x5b, flags: 0x0}, + 436: {region: 0x10, script: 0x3, flags: 0x1}, + 437: {region: 0x166, script: 0x5b, flags: 0x0}, + 438: {region: 0x53, script: 0x3b, flags: 0x0}, + 439: {region: 0x166, script: 0x5b, flags: 0x0}, + 440: {region: 0x136, script: 0x5b, flags: 0x0}, + 441: {region: 0x24, script: 0x5, flags: 0x0}, + 442: {region: 0x166, script: 0x5b, flags: 0x0}, + 443: {region: 0x166, script: 0x2c, flags: 0x0}, + 444: {region: 0x98, script: 0x3e, flags: 0x0}, + 445: {region: 0x166, script: 0x5b, flags: 0x0}, + 446: {region: 0x9a, script: 0x22, flags: 0x0}, + 447: {region: 0x166, script: 0x5b, flags: 0x0}, + 448: {region: 0x74, script: 0x5b, flags: 0x0}, + 449: {region: 0x166, script: 0x5b, flags: 0x0}, + 450: {region: 0x166, script: 0x5b, flags: 0x0}, + 451: {region: 0xe8, script: 0x5b, flags: 0x0}, + 452: {region: 0x166, script: 0x5b, flags: 0x0}, + 453: {region: 0x12c, script: 0x40, flags: 0x0}, + 454: {region: 0x53, script: 0x92, flags: 0x0}, + 455: {region: 0x166, script: 0x5b, flags: 0x0}, + 456: {region: 0xe9, script: 0x5, flags: 0x0}, + 457: {region: 0x9a, script: 0x22, flags: 0x0}, + 458: {region: 0xb0, script: 0x41, flags: 0x0}, + 459: {region: 0xe8, script: 0x5b, flags: 0x0}, + 460: {region: 0xe9, script: 0x5, flags: 0x0}, + 461: {region: 0xe7, script: 0x5b, flags: 0x0}, + 462: {region: 0x9a, script: 0x22, flags: 0x0}, + 463: {region: 0x9a, script: 0x22, flags: 0x0}, + 464: {region: 0x166, script: 0x5b, flags: 0x0}, + 465: {region: 0x91, script: 0x5b, flags: 0x0}, + 466: {region: 0x61, script: 0x5b, flags: 0x0}, + 467: {region: 0x53, script: 0x3b, flags: 0x0}, + 468: {region: 0x92, script: 0x5b, flags: 0x0}, + 469: {region: 0x93, script: 0x5b, flags: 0x0}, + 470: {region: 0x166, script: 0x5b, flags: 0x0}, + 471: {region: 0x28, script: 0x8, flags: 0x0}, + 472: {region: 0xd3, script: 0x5b, flags: 0x0}, + 473: {region: 0x79, script: 0x5b, flags: 0x0}, + 474: {region: 0x166, script: 0x5b, flags: 0x0}, + 475: {region: 0x166, script: 0x5b, flags: 0x0}, + 476: {region: 0xd1, script: 0x5b, flags: 0x0}, + 477: {region: 0xd7, script: 0x5b, flags: 0x0}, + 478: {region: 0x166, script: 0x5b, flags: 0x0}, + 479: {region: 0x166, script: 0x5b, flags: 0x0}, + 480: {region: 0x166, script: 0x5b, flags: 0x0}, + 481: {region: 0x96, script: 0x5b, flags: 0x0}, + 482: {region: 0x166, script: 0x5b, flags: 0x0}, + 483: {region: 0x166, script: 0x5b, flags: 0x0}, + 484: {region: 0x166, script: 0x5b, flags: 0x0}, + 486: {region: 0x123, script: 0x5b, flags: 0x0}, + 487: {region: 0xd7, script: 0x5b, flags: 0x0}, + 488: {region: 0x166, script: 0x5b, flags: 0x0}, + 489: {region: 0x166, script: 0x5b, flags: 0x0}, + 490: {region: 0x53, script: 0xfd, flags: 0x0}, + 491: {region: 0x166, script: 0x5b, flags: 0x0}, + 492: {region: 0x136, script: 0x5b, flags: 0x0}, + 493: {region: 0x166, script: 0x5b, flags: 0x0}, + 494: {region: 0x49, script: 0x5b, flags: 0x0}, + 495: {region: 0x166, script: 0x5b, flags: 0x0}, + 496: {region: 0x166, script: 0x5b, flags: 0x0}, + 497: {region: 0xe8, script: 0x5b, flags: 0x0}, + 498: {region: 0x166, script: 0x5b, flags: 0x0}, + 499: {region: 0x96, script: 0x5b, flags: 0x0}, + 500: {region: 0x107, script: 0x20, flags: 0x0}, + 501: {region: 0x1, script: 0x5b, flags: 0x0}, + 502: {region: 0x166, script: 0x5b, flags: 0x0}, + 503: {region: 0x166, script: 0x5b, flags: 0x0}, + 504: {region: 0x9e, script: 0x5b, flags: 0x0}, + 505: {region: 0x9f, script: 0x5b, flags: 0x0}, + 506: {region: 0x49, script: 0x17, flags: 0x0}, + 507: {region: 0x98, script: 0x3e, flags: 0x0}, + 508: {region: 0x166, script: 0x5b, flags: 0x0}, + 509: {region: 0x166, script: 0x5b, flags: 0x0}, + 510: {region: 0x107, script: 0x5b, flags: 0x0}, + 511: {region: 0x166, script: 0x5b, flags: 0x0}, + 512: {region: 0xa3, script: 0x49, flags: 0x0}, + 513: {region: 0x166, script: 0x5b, flags: 0x0}, + 514: {region: 0xa1, script: 0x5b, flags: 0x0}, + 515: {region: 0x1, script: 0x5b, flags: 0x0}, + 516: {region: 0x166, script: 0x5b, flags: 0x0}, + 517: {region: 0x166, script: 0x5b, flags: 0x0}, + 518: {region: 0x166, script: 0x5b, flags: 0x0}, + 519: {region: 0x52, script: 0x5b, flags: 0x0}, + 520: {region: 0x131, script: 0x3e, flags: 0x0}, + 521: {region: 0x166, script: 0x5b, flags: 0x0}, + 522: {region: 0x130, script: 0x5b, flags: 0x0}, + 523: {region: 0xdc, script: 0x22, flags: 0x0}, + 524: {region: 0x166, script: 0x5b, flags: 0x0}, + 525: {region: 0x64, script: 0x5b, flags: 0x0}, + 526: {region: 0x96, script: 0x5b, flags: 0x0}, + 527: {region: 0x96, script: 0x5b, flags: 0x0}, + 528: {region: 0x7e, script: 0x2e, flags: 0x0}, + 529: {region: 0x138, script: 0x20, flags: 0x0}, + 530: {region: 0x68, script: 0x5b, flags: 0x0}, + 531: {region: 0xc5, script: 0x5b, flags: 0x0}, + 532: {region: 0x166, script: 0x5b, flags: 0x0}, + 533: {region: 0x166, script: 0x5b, flags: 0x0}, + 534: {region: 0xd7, script: 0x5b, flags: 0x0}, + 535: {region: 0xa5, script: 0x5b, flags: 0x0}, + 536: {region: 0xc4, script: 0x5b, flags: 0x0}, + 537: {region: 0x107, script: 0x20, flags: 0x0}, + 538: {region: 0x166, script: 0x5b, flags: 0x0}, + 539: {region: 0x166, script: 0x5b, flags: 0x0}, + 540: {region: 0x166, script: 0x5b, flags: 0x0}, + 541: {region: 0x166, script: 0x5b, flags: 0x0}, + 542: {region: 0xd5, script: 0x5, flags: 0x0}, + 543: {region: 0xd7, script: 0x5b, flags: 0x0}, + 544: {region: 0x165, script: 0x5b, flags: 0x0}, + 545: {region: 0x166, script: 0x5b, flags: 0x0}, + 546: {region: 0x166, script: 0x5b, flags: 0x0}, + 547: {region: 0x130, script: 0x5b, flags: 0x0}, + 548: {region: 0x123, script: 0x5, flags: 0x0}, + 549: {region: 0x166, script: 0x5b, flags: 0x0}, + 550: {region: 0x124, script: 0xee, flags: 0x0}, + 551: {region: 0x5b, script: 0x5b, flags: 0x0}, + 552: {region: 0x52, script: 0x5b, flags: 0x0}, + 553: {region: 0x166, script: 0x5b, flags: 0x0}, + 554: {region: 0x4f, script: 0x5b, flags: 0x0}, + 555: {region: 0x9a, script: 0x22, flags: 0x0}, + 556: {region: 0x9a, script: 0x22, flags: 0x0}, + 557: {region: 0x4b, script: 0x5b, flags: 0x0}, + 558: {region: 0x96, script: 0x5b, flags: 0x0}, + 559: {region: 0x166, script: 0x5b, flags: 0x0}, + 560: {region: 0x41, script: 0x5b, flags: 0x0}, + 561: {region: 0x9a, script: 0x5b, flags: 0x0}, + 562: {region: 0x53, script: 0xe5, flags: 0x0}, + 563: {region: 0x9a, script: 0x22, flags: 0x0}, + 564: {region: 0xc4, script: 0x5b, flags: 0x0}, + 565: {region: 0x166, script: 0x5b, flags: 0x0}, + 566: {region: 0x9a, script: 0x76, flags: 0x0}, + 567: {region: 0xe9, script: 0x5, flags: 0x0}, + 568: {region: 0x166, script: 0x5b, flags: 0x0}, + 569: {region: 0xa5, script: 0x5b, flags: 0x0}, + 570: {region: 0x166, script: 0x5b, flags: 0x0}, + 571: {region: 0x12c, script: 0x5b, flags: 0x0}, + 572: {region: 0x166, script: 0x5b, flags: 0x0}, + 573: {region: 0xd3, script: 0x5b, flags: 0x0}, + 574: {region: 0x166, script: 0x5b, flags: 0x0}, + 575: {region: 0xb0, script: 0x58, flags: 0x0}, + 576: {region: 0x166, script: 0x5b, flags: 0x0}, + 577: {region: 0x166, script: 0x5b, flags: 0x0}, + 578: {region: 0x13, script: 0x6, flags: 0x1}, + 579: {region: 0x166, script: 0x5b, flags: 0x0}, + 580: {region: 0x52, script: 0x5b, flags: 0x0}, + 581: {region: 0x83, script: 0x5b, flags: 0x0}, + 582: {region: 0xa5, script: 0x5b, flags: 0x0}, + 583: {region: 0x166, script: 0x5b, flags: 0x0}, + 584: {region: 0x166, script: 0x5b, flags: 0x0}, + 585: {region: 0x166, script: 0x5b, flags: 0x0}, + 586: {region: 0xa7, script: 0x4f, flags: 0x0}, + 587: {region: 0x2a, script: 0x5b, flags: 0x0}, + 588: {region: 0x166, script: 0x5b, flags: 0x0}, + 589: {region: 0x166, script: 0x5b, flags: 0x0}, + 590: {region: 0x166, script: 0x5b, flags: 0x0}, + 591: {region: 0x166, script: 0x5b, flags: 0x0}, + 592: {region: 0x166, script: 0x5b, flags: 0x0}, + 593: {region: 0x9a, script: 0x53, flags: 0x0}, + 594: {region: 0x8c, script: 0x5b, flags: 0x0}, + 595: {region: 0x166, script: 0x5b, flags: 0x0}, + 596: {region: 0xac, script: 0x54, flags: 0x0}, + 597: {region: 0x107, script: 0x20, flags: 0x0}, + 598: {region: 0x9a, script: 0x22, flags: 0x0}, + 599: {region: 0x166, script: 0x5b, flags: 0x0}, + 600: {region: 0x76, script: 0x5b, flags: 0x0}, + 601: {region: 0x166, script: 0x5b, flags: 0x0}, + 602: {region: 0xb5, script: 0x5b, flags: 0x0}, + 603: {region: 0x166, script: 0x5b, flags: 0x0}, + 604: {region: 0x166, script: 0x5b, flags: 0x0}, + 605: {region: 0x166, script: 0x5b, flags: 0x0}, + 606: {region: 0x166, script: 0x5b, flags: 0x0}, + 607: {region: 0x166, script: 0x5b, flags: 0x0}, + 608: {region: 0x166, script: 0x5b, flags: 0x0}, + 609: {region: 0x166, script: 0x5b, flags: 0x0}, + 610: {region: 0x166, script: 0x2c, flags: 0x0}, + 611: {region: 0x166, script: 0x5b, flags: 0x0}, + 612: {region: 0x107, script: 0x20, flags: 0x0}, + 613: {region: 0x113, script: 0x5b, flags: 0x0}, + 614: {region: 0xe8, script: 0x5b, flags: 0x0}, + 615: {region: 0x107, script: 0x5b, flags: 0x0}, + 616: {region: 0x166, script: 0x5b, flags: 0x0}, + 617: {region: 0x9a, script: 0x22, flags: 0x0}, + 618: {region: 0x9a, script: 0x5, flags: 0x0}, + 619: {region: 0x130, script: 0x5b, flags: 0x0}, + 620: {region: 0x166, script: 0x5b, flags: 0x0}, + 621: {region: 0x52, script: 0x5b, flags: 0x0}, + 622: {region: 0x61, script: 0x5b, flags: 0x0}, + 623: {region: 0x166, script: 0x5b, flags: 0x0}, + 624: {region: 0x166, script: 0x5b, flags: 0x0}, + 625: {region: 0x166, script: 0x2c, flags: 0x0}, + 626: {region: 0x166, script: 0x5b, flags: 0x0}, + 627: {region: 0x166, script: 0x5b, flags: 0x0}, + 628: {region: 0x19, script: 0x3, flags: 0x1}, + 629: {region: 0x166, script: 0x5b, flags: 0x0}, + 630: {region: 0x166, script: 0x5b, flags: 0x0}, + 631: {region: 0x166, script: 0x5b, flags: 0x0}, + 632: {region: 0x166, script: 0x5b, flags: 0x0}, + 633: {region: 0x107, script: 0x20, flags: 0x0}, + 634: {region: 0x166, script: 0x5b, flags: 0x0}, + 635: {region: 0x166, script: 0x5b, flags: 0x0}, + 636: {region: 0x166, script: 0x5b, flags: 0x0}, + 637: {region: 0x107, script: 0x20, flags: 0x0}, + 638: {region: 0x166, script: 0x5b, flags: 0x0}, + 639: {region: 0x96, script: 0x5b, flags: 0x0}, + 640: {region: 0xe9, script: 0x5, flags: 0x0}, + 641: {region: 0x7c, script: 0x5b, flags: 0x0}, + 642: {region: 0x166, script: 0x5b, flags: 0x0}, + 643: {region: 0x166, script: 0x5b, flags: 0x0}, + 644: {region: 0x166, script: 0x5b, flags: 0x0}, + 645: {region: 0x166, script: 0x2c, flags: 0x0}, + 646: {region: 0x124, script: 0xee, flags: 0x0}, + 647: {region: 0xe9, script: 0x5, flags: 0x0}, + 648: {region: 0x166, script: 0x5b, flags: 0x0}, + 649: {region: 0x166, script: 0x5b, flags: 0x0}, + 650: {region: 0x1c, script: 0x5, flags: 0x1}, + 651: {region: 0x166, script: 0x5b, flags: 0x0}, + 652: {region: 0x166, script: 0x5b, flags: 0x0}, + 653: {region: 0x166, script: 0x5b, flags: 0x0}, + 654: {region: 0x139, script: 0x5b, flags: 0x0}, + 655: {region: 0x88, script: 0x5f, flags: 0x0}, + 656: {region: 0x98, script: 0x3e, flags: 0x0}, + 657: {region: 0x130, script: 0x5b, flags: 0x0}, + 658: {region: 0xe9, script: 0x5, flags: 0x0}, + 659: {region: 0x132, script: 0x5b, flags: 0x0}, + 660: {region: 0x166, script: 0x5b, flags: 0x0}, + 661: {region: 0xb8, script: 0x5b, flags: 0x0}, + 662: {region: 0x107, script: 0x20, flags: 0x0}, + 663: {region: 0x166, script: 0x5b, flags: 0x0}, + 664: {region: 0x96, script: 0x5b, flags: 0x0}, + 665: {region: 0x166, script: 0x5b, flags: 0x0}, + 666: {region: 0x53, script: 0xee, flags: 0x0}, + 667: {region: 0x166, script: 0x5b, flags: 0x0}, + 668: {region: 0x166, script: 0x5b, flags: 0x0}, + 669: {region: 0x166, script: 0x5b, flags: 0x0}, + 670: {region: 0x166, script: 0x5b, flags: 0x0}, + 671: {region: 0x9a, script: 0x5d, flags: 0x0}, + 672: {region: 0x166, script: 0x5b, flags: 0x0}, + 673: {region: 0x166, script: 0x5b, flags: 0x0}, + 674: {region: 0x107, script: 0x20, flags: 0x0}, + 675: {region: 0x132, script: 0x5b, flags: 0x0}, + 676: {region: 0x166, script: 0x5b, flags: 0x0}, + 677: {region: 0xda, script: 0x5b, flags: 0x0}, + 678: {region: 0x166, script: 0x5b, flags: 0x0}, + 679: {region: 0x166, script: 0x5b, flags: 0x0}, + 680: {region: 0x21, script: 0x2, flags: 0x1}, + 681: {region: 0x166, script: 0x5b, flags: 0x0}, + 682: {region: 0x166, script: 0x5b, flags: 0x0}, + 683: {region: 0x9f, script: 0x5b, flags: 0x0}, + 684: {region: 0x53, script: 0x61, flags: 0x0}, + 685: {region: 0x96, script: 0x5b, flags: 0x0}, + 686: {region: 0x9d, script: 0x5, flags: 0x0}, + 687: {region: 0x136, script: 0x5b, flags: 0x0}, + 688: {region: 0x166, script: 0x5b, flags: 0x0}, + 689: {region: 0x166, script: 0x5b, flags: 0x0}, + 690: {region: 0x9a, script: 0xe9, flags: 0x0}, + 691: {region: 0x9f, script: 0x5b, flags: 0x0}, + 692: {region: 0x166, script: 0x5b, flags: 0x0}, + 693: {region: 0x4b, script: 0x5b, flags: 0x0}, + 694: {region: 0x166, script: 0x5b, flags: 0x0}, + 695: {region: 0x166, script: 0x5b, flags: 0x0}, + 696: {region: 0xb0, script: 0x58, flags: 0x0}, + 697: {region: 0x166, script: 0x5b, flags: 0x0}, + 698: {region: 0x166, script: 0x5b, flags: 0x0}, + 699: {region: 0x4b, script: 0x5b, flags: 0x0}, + 700: {region: 0x166, script: 0x5b, flags: 0x0}, + 701: {region: 0x166, script: 0x5b, flags: 0x0}, + 702: {region: 0x163, script: 0x5b, flags: 0x0}, + 703: {region: 0x9d, script: 0x5, flags: 0x0}, + 704: {region: 0xb7, script: 0x5b, flags: 0x0}, + 705: {region: 0xb9, script: 0x5b, flags: 0x0}, + 706: {region: 0x4b, script: 0x5b, flags: 0x0}, + 707: {region: 0x4b, script: 0x5b, flags: 0x0}, + 708: {region: 0xa5, script: 0x5b, flags: 0x0}, + 709: {region: 0xa5, script: 0x5b, flags: 0x0}, + 710: {region: 0x9d, script: 0x5, flags: 0x0}, + 711: {region: 0xb9, script: 0x5b, flags: 0x0}, + 712: {region: 0x124, script: 0xee, flags: 0x0}, + 713: {region: 0x53, script: 0x3b, flags: 0x0}, + 714: {region: 0x12c, script: 0x5b, flags: 0x0}, + 715: {region: 0x96, script: 0x5b, flags: 0x0}, + 716: {region: 0x52, script: 0x5b, flags: 0x0}, + 717: {region: 0x9a, script: 0x22, flags: 0x0}, + 718: {region: 0x9a, script: 0x22, flags: 0x0}, + 719: {region: 0x96, script: 0x5b, flags: 0x0}, + 720: {region: 0x23, script: 0x3, flags: 0x1}, + 721: {region: 0xa5, script: 0x5b, flags: 0x0}, + 722: {region: 0x166, script: 0x5b, flags: 0x0}, + 723: {region: 0xd0, script: 0x5b, flags: 0x0}, + 724: {region: 0x166, script: 0x5b, flags: 0x0}, + 725: {region: 0x166, script: 0x5b, flags: 0x0}, + 726: {region: 0x166, script: 0x5b, flags: 0x0}, + 727: {region: 0x166, script: 0x5b, flags: 0x0}, + 728: {region: 0x166, script: 0x5b, flags: 0x0}, + 729: {region: 0x166, script: 0x5b, flags: 0x0}, + 730: {region: 0x166, script: 0x5b, flags: 0x0}, + 731: {region: 0x166, script: 0x5b, flags: 0x0}, + 732: {region: 0x166, script: 0x5b, flags: 0x0}, + 733: {region: 0x166, script: 0x5b, flags: 0x0}, + 734: {region: 0x166, script: 0x5b, flags: 0x0}, + 735: {region: 0x166, script: 0x5, flags: 0x0}, + 736: {region: 0x107, script: 0x20, flags: 0x0}, + 737: {region: 0xe8, script: 0x5b, flags: 0x0}, + 738: {region: 0x166, script: 0x5b, flags: 0x0}, + 739: {region: 0x96, script: 0x5b, flags: 0x0}, + 740: {region: 0x166, script: 0x2c, flags: 0x0}, + 741: {region: 0x166, script: 0x5b, flags: 0x0}, + 742: {region: 0x166, script: 0x5b, flags: 0x0}, + 743: {region: 0x166, script: 0x5b, flags: 0x0}, + 744: {region: 0x113, script: 0x5b, flags: 0x0}, + 745: {region: 0xa5, script: 0x5b, flags: 0x0}, + 746: {region: 0x166, script: 0x5b, flags: 0x0}, + 747: {region: 0x166, script: 0x5b, flags: 0x0}, + 748: {region: 0x124, script: 0x5, flags: 0x0}, + 749: {region: 0xcd, script: 0x5b, flags: 0x0}, + 750: {region: 0x166, script: 0x5b, flags: 0x0}, + 751: {region: 0x166, script: 0x5b, flags: 0x0}, + 752: {region: 0x166, script: 0x5b, flags: 0x0}, + 753: {region: 0xc0, script: 0x5b, flags: 0x0}, + 754: {region: 0xd2, script: 0x5b, flags: 0x0}, + 755: {region: 0x166, script: 0x5b, flags: 0x0}, + 756: {region: 0x52, script: 0x5b, flags: 0x0}, + 757: {region: 0xdc, script: 0x22, flags: 0x0}, + 758: {region: 0x130, script: 0x5b, flags: 0x0}, + 759: {region: 0xc1, script: 0x5b, flags: 0x0}, + 760: {region: 0x166, script: 0x5b, flags: 0x0}, + 761: {region: 0x166, script: 0x5b, flags: 0x0}, + 762: {region: 0xe1, script: 0x5b, flags: 0x0}, + 763: {region: 0x166, script: 0x5b, flags: 0x0}, + 764: {region: 0x96, script: 0x5b, flags: 0x0}, + 765: {region: 0x9c, script: 0x3d, flags: 0x0}, + 766: {region: 0x166, script: 0x5b, flags: 0x0}, + 767: {region: 0xc3, script: 0x20, flags: 0x0}, + 768: {region: 0x166, script: 0x5, flags: 0x0}, + 769: {region: 0x166, script: 0x5b, flags: 0x0}, + 770: {region: 0x166, script: 0x5b, flags: 0x0}, + 771: {region: 0x166, script: 0x5b, flags: 0x0}, + 772: {region: 0x9a, script: 0x6f, flags: 0x0}, + 773: {region: 0x166, script: 0x5b, flags: 0x0}, + 774: {region: 0x166, script: 0x5b, flags: 0x0}, + 775: {region: 0x10c, script: 0x5b, flags: 0x0}, + 776: {region: 0x166, script: 0x5b, flags: 0x0}, + 777: {region: 0x166, script: 0x5b, flags: 0x0}, + 778: {region: 0x166, script: 0x5b, flags: 0x0}, + 779: {region: 0x26, script: 0x3, flags: 0x1}, + 780: {region: 0x166, script: 0x5b, flags: 0x0}, + 781: {region: 0x166, script: 0x5b, flags: 0x0}, + 782: {region: 0x9a, script: 0xe, flags: 0x0}, + 783: {region: 0xc5, script: 0x76, flags: 0x0}, + 785: {region: 0x166, script: 0x5b, flags: 0x0}, + 786: {region: 0x49, script: 0x5b, flags: 0x0}, + 787: {region: 0x49, script: 0x5b, flags: 0x0}, + 788: {region: 0x37, script: 0x5b, flags: 0x0}, + 789: {region: 0x166, script: 0x5b, flags: 0x0}, + 790: {region: 0x166, script: 0x5b, flags: 0x0}, + 791: {region: 0x166, script: 0x5b, flags: 0x0}, + 792: {region: 0x166, script: 0x5b, flags: 0x0}, + 793: {region: 0x166, script: 0x5b, flags: 0x0}, + 794: {region: 0x166, script: 0x5b, flags: 0x0}, + 795: {region: 0x9a, script: 0x22, flags: 0x0}, + 796: {region: 0xdc, script: 0x22, flags: 0x0}, + 797: {region: 0x107, script: 0x20, flags: 0x0}, + 798: {region: 0x35, script: 0x73, flags: 0x0}, + 799: {region: 0x29, script: 0x3, flags: 0x1}, + 800: {region: 0xcc, script: 0x5b, flags: 0x0}, + 801: {region: 0x166, script: 0x5b, flags: 0x0}, + 802: {region: 0x166, script: 0x5b, flags: 0x0}, + 803: {region: 0x166, script: 0x5b, flags: 0x0}, + 804: {region: 0x9a, script: 0x22, flags: 0x0}, + 805: {region: 0x52, script: 0x5b, flags: 0x0}, + 807: {region: 0x166, script: 0x5b, flags: 0x0}, + 808: {region: 0x136, script: 0x5b, flags: 0x0}, + 809: {region: 0x166, script: 0x5b, flags: 0x0}, + 810: {region: 0x166, script: 0x5b, flags: 0x0}, + 811: {region: 0xe9, script: 0x5, flags: 0x0}, + 812: {region: 0xc4, script: 0x5b, flags: 0x0}, + 813: {region: 0x9a, script: 0x22, flags: 0x0}, + 814: {region: 0x96, script: 0x5b, flags: 0x0}, + 815: {region: 0x165, script: 0x5b, flags: 0x0}, + 816: {region: 0x166, script: 0x5b, flags: 0x0}, + 817: {region: 0xc5, script: 0x76, flags: 0x0}, + 818: {region: 0x166, script: 0x5b, flags: 0x0}, + 819: {region: 0x166, script: 0x2c, flags: 0x0}, + 820: {region: 0x107, script: 0x20, flags: 0x0}, + 821: {region: 0x166, script: 0x5b, flags: 0x0}, + 822: {region: 0x132, script: 0x5b, flags: 0x0}, + 823: {region: 0x9d, script: 0x67, flags: 0x0}, + 824: {region: 0x166, script: 0x5b, flags: 0x0}, + 825: {region: 0x166, script: 0x5b, flags: 0x0}, + 826: {region: 0x9d, script: 0x5, flags: 0x0}, + 827: {region: 0x166, script: 0x5b, flags: 0x0}, + 828: {region: 0x166, script: 0x5b, flags: 0x0}, + 829: {region: 0x166, script: 0x5b, flags: 0x0}, + 830: {region: 0xde, script: 0x5b, flags: 0x0}, + 831: {region: 0x166, script: 0x5b, flags: 0x0}, + 832: {region: 0x166, script: 0x5b, flags: 0x0}, + 834: {region: 0x166, script: 0x5b, flags: 0x0}, + 835: {region: 0x53, script: 0x3b, flags: 0x0}, + 836: {region: 0x9f, script: 0x5b, flags: 0x0}, + 837: {region: 0xd3, script: 0x5b, flags: 0x0}, + 838: {region: 0x166, script: 0x5b, flags: 0x0}, + 839: {region: 0xdb, script: 0x5b, flags: 0x0}, + 840: {region: 0x166, script: 0x5b, flags: 0x0}, + 841: {region: 0x166, script: 0x5b, flags: 0x0}, + 842: {region: 0x166, script: 0x5b, flags: 0x0}, + 843: {region: 0xd0, script: 0x5b, flags: 0x0}, + 844: {region: 0x166, script: 0x5b, flags: 0x0}, + 845: {region: 0x166, script: 0x5b, flags: 0x0}, + 846: {region: 0x165, script: 0x5b, flags: 0x0}, + 847: {region: 0xd2, script: 0x5b, flags: 0x0}, + 848: {region: 0x61, script: 0x5b, flags: 0x0}, + 849: {region: 0xdc, script: 0x22, flags: 0x0}, + 850: {region: 0x166, script: 0x5b, flags: 0x0}, + 851: {region: 0xdc, script: 0x22, flags: 0x0}, + 852: {region: 0x166, script: 0x5b, flags: 0x0}, + 853: {region: 0x166, script: 0x5b, flags: 0x0}, + 854: {region: 0xd3, script: 0x5b, flags: 0x0}, + 855: {region: 0x166, script: 0x5b, flags: 0x0}, + 856: {region: 0x166, script: 0x5b, flags: 0x0}, + 857: {region: 0xd2, script: 0x5b, flags: 0x0}, + 858: {region: 0x166, script: 0x5b, flags: 0x0}, + 859: {region: 0xd0, script: 0x5b, flags: 0x0}, + 860: {region: 0xd0, script: 0x5b, flags: 0x0}, + 861: {region: 0x166, script: 0x5b, flags: 0x0}, + 862: {region: 0x166, script: 0x5b, flags: 0x0}, + 863: {region: 0x96, script: 0x5b, flags: 0x0}, + 864: {region: 0x166, script: 0x5b, flags: 0x0}, + 865: {region: 0xe0, script: 0x5b, flags: 0x0}, + 866: {region: 0x166, script: 0x5b, flags: 0x0}, + 867: {region: 0x166, script: 0x5b, flags: 0x0}, + 868: {region: 0x9a, script: 0x5b, flags: 0x0}, + 869: {region: 0x166, script: 0x5b, flags: 0x0}, + 870: {region: 0x166, script: 0x5b, flags: 0x0}, + 871: {region: 0xda, script: 0x5b, flags: 0x0}, + 872: {region: 0x52, script: 0x5b, flags: 0x0}, + 873: {region: 0x166, script: 0x5b, flags: 0x0}, + 874: {region: 0xdb, script: 0x5b, flags: 0x0}, + 875: {region: 0x166, script: 0x5b, flags: 0x0}, + 876: {region: 0x52, script: 0x5b, flags: 0x0}, + 877: {region: 0x166, script: 0x5b, flags: 0x0}, + 878: {region: 0x166, script: 0x5b, flags: 0x0}, + 879: {region: 0xdb, script: 0x5b, flags: 0x0}, + 880: {region: 0x124, script: 0x57, flags: 0x0}, + 881: {region: 0x9a, script: 0x22, flags: 0x0}, + 882: {region: 0x10d, script: 0xcb, flags: 0x0}, + 883: {region: 0x166, script: 0x5b, flags: 0x0}, + 884: {region: 0x166, script: 0x5b, flags: 0x0}, + 885: {region: 0x85, script: 0x7e, flags: 0x0}, + 886: {region: 0x162, script: 0x5b, flags: 0x0}, + 887: {region: 0x166, script: 0x5b, flags: 0x0}, + 888: {region: 0x49, script: 0x17, flags: 0x0}, + 889: {region: 0x166, script: 0x5b, flags: 0x0}, + 890: {region: 0x162, script: 0x5b, flags: 0x0}, + 891: {region: 0x166, script: 0x5b, flags: 0x0}, + 892: {region: 0x166, script: 0x5b, flags: 0x0}, + 893: {region: 0x166, script: 0x5b, flags: 0x0}, + 894: {region: 0x166, script: 0x5b, flags: 0x0}, + 895: {region: 0x166, script: 0x5b, flags: 0x0}, + 896: {region: 0x118, script: 0x5b, flags: 0x0}, + 897: {region: 0x166, script: 0x5b, flags: 0x0}, + 898: {region: 0x166, script: 0x5b, flags: 0x0}, + 899: {region: 0x136, script: 0x5b, flags: 0x0}, + 900: {region: 0x166, script: 0x5b, flags: 0x0}, + 901: {region: 0x53, script: 0x5b, flags: 0x0}, + 902: {region: 0x166, script: 0x5b, flags: 0x0}, + 903: {region: 0xcf, script: 0x5b, flags: 0x0}, + 904: {region: 0x130, script: 0x5b, flags: 0x0}, + 905: {region: 0x132, script: 0x5b, flags: 0x0}, + 906: {region: 0x81, script: 0x5b, flags: 0x0}, + 907: {region: 0x79, script: 0x5b, flags: 0x0}, + 908: {region: 0x166, script: 0x5b, flags: 0x0}, + 910: {region: 0x166, script: 0x5b, flags: 0x0}, + 911: {region: 0x166, script: 0x5b, flags: 0x0}, + 912: {region: 0x70, script: 0x5b, flags: 0x0}, + 913: {region: 0x166, script: 0x5b, flags: 0x0}, + 914: {region: 0x166, script: 0x5b, flags: 0x0}, + 915: {region: 0x166, script: 0x5b, flags: 0x0}, + 916: {region: 0x166, script: 0x5b, flags: 0x0}, + 917: {region: 0x9a, script: 0x83, flags: 0x0}, + 918: {region: 0x166, script: 0x5b, flags: 0x0}, + 919: {region: 0x166, script: 0x5, flags: 0x0}, + 920: {region: 0x7e, script: 0x20, flags: 0x0}, + 921: {region: 0x136, script: 0x84, flags: 0x0}, + 922: {region: 0x166, script: 0x5, flags: 0x0}, + 923: {region: 0xc6, script: 0x82, flags: 0x0}, + 924: {region: 0x166, script: 0x5b, flags: 0x0}, + 925: {region: 0x2c, script: 0x3, flags: 0x1}, + 926: {region: 0xe8, script: 0x5b, flags: 0x0}, + 927: {region: 0x2f, script: 0x2, flags: 0x1}, + 928: {region: 0xe8, script: 0x5b, flags: 0x0}, + 929: {region: 0x30, script: 0x5b, flags: 0x0}, + 930: {region: 0xf1, script: 0x5b, flags: 0x0}, + 931: {region: 0x166, script: 0x5b, flags: 0x0}, + 932: {region: 0x79, script: 0x5b, flags: 0x0}, + 933: {region: 0xd7, script: 0x5b, flags: 0x0}, + 934: {region: 0x136, script: 0x5b, flags: 0x0}, + 935: {region: 0x49, script: 0x5b, flags: 0x0}, + 936: {region: 0x166, script: 0x5b, flags: 0x0}, + 937: {region: 0x9d, script: 0xfa, flags: 0x0}, + 938: {region: 0x166, script: 0x5b, flags: 0x0}, + 939: {region: 0x61, script: 0x5b, flags: 0x0}, + 940: {region: 0x166, script: 0x5, flags: 0x0}, + 941: {region: 0xb1, script: 0x90, flags: 0x0}, + 943: {region: 0x166, script: 0x5b, flags: 0x0}, + 944: {region: 0x166, script: 0x5b, flags: 0x0}, + 945: {region: 0x9a, script: 0x12, flags: 0x0}, + 946: {region: 0xa5, script: 0x5b, flags: 0x0}, + 947: {region: 0xea, script: 0x5b, flags: 0x0}, + 948: {region: 0x166, script: 0x5b, flags: 0x0}, + 949: {region: 0x9f, script: 0x5b, flags: 0x0}, + 950: {region: 0x166, script: 0x5b, flags: 0x0}, + 951: {region: 0x166, script: 0x5b, flags: 0x0}, + 952: {region: 0x88, script: 0x34, flags: 0x0}, + 953: {region: 0x76, script: 0x5b, flags: 0x0}, + 954: {region: 0x166, script: 0x5b, flags: 0x0}, + 955: {region: 0xe9, script: 0x4e, flags: 0x0}, + 956: {region: 0x9d, script: 0x5, flags: 0x0}, + 957: {region: 0x1, script: 0x5b, flags: 0x0}, + 958: {region: 0x24, script: 0x5, flags: 0x0}, + 959: {region: 0x166, script: 0x5b, flags: 0x0}, + 960: {region: 0x41, script: 0x5b, flags: 0x0}, + 961: {region: 0x166, script: 0x5b, flags: 0x0}, + 962: {region: 0x7b, script: 0x5b, flags: 0x0}, + 963: {region: 0x166, script: 0x5b, flags: 0x0}, + 964: {region: 0xe5, script: 0x5b, flags: 0x0}, + 965: {region: 0x8a, script: 0x5b, flags: 0x0}, + 966: {region: 0x6a, script: 0x5b, flags: 0x0}, + 967: {region: 0x166, script: 0x5b, flags: 0x0}, + 968: {region: 0x9a, script: 0x22, flags: 0x0}, + 969: {region: 0x166, script: 0x5b, flags: 0x0}, + 970: {region: 0x103, script: 0x5b, flags: 0x0}, + 971: {region: 0x96, script: 0x5b, flags: 0x0}, + 972: {region: 0x166, script: 0x5b, flags: 0x0}, + 973: {region: 0x166, script: 0x5b, flags: 0x0}, + 974: {region: 0x9f, script: 0x5b, flags: 0x0}, + 975: {region: 0x166, script: 0x5, flags: 0x0}, + 976: {region: 0x9a, script: 0x5b, flags: 0x0}, + 977: {region: 0x31, script: 0x2, flags: 0x1}, + 978: {region: 0xdc, script: 0x22, flags: 0x0}, + 979: {region: 0x35, script: 0xe, flags: 0x0}, + 980: {region: 0x4e, script: 0x5b, flags: 0x0}, + 981: {region: 0x73, script: 0x5b, flags: 0x0}, + 982: {region: 0x4e, script: 0x5b, flags: 0x0}, + 983: {region: 0x9d, script: 0x5, flags: 0x0}, + 984: {region: 0x10d, script: 0x5b, flags: 0x0}, + 985: {region: 0x3a, script: 0x5b, flags: 0x0}, + 986: {region: 0x166, script: 0x5b, flags: 0x0}, + 987: {region: 0xd2, script: 0x5b, flags: 0x0}, + 988: {region: 0x105, script: 0x5b, flags: 0x0}, + 989: {region: 0x96, script: 0x5b, flags: 0x0}, + 990: {region: 0x130, script: 0x5b, flags: 0x0}, + 991: {region: 0x166, script: 0x5b, flags: 0x0}, + 992: {region: 0x166, script: 0x5b, flags: 0x0}, + 993: {region: 0x74, script: 0x5b, flags: 0x0}, + 994: {region: 0x107, script: 0x20, flags: 0x0}, + 995: {region: 0x131, script: 0x20, flags: 0x0}, + 996: {region: 0x10a, script: 0x5b, flags: 0x0}, + 997: {region: 0x108, script: 0x5b, flags: 0x0}, + 998: {region: 0x130, script: 0x5b, flags: 0x0}, + 999: {region: 0x166, script: 0x5b, flags: 0x0}, + 1000: {region: 0xa3, script: 0x4c, flags: 0x0}, + 1001: {region: 0x9a, script: 0x22, flags: 0x0}, + 1002: {region: 0x81, script: 0x5b, flags: 0x0}, + 1003: {region: 0x107, script: 0x20, flags: 0x0}, + 1004: {region: 0xa5, script: 0x5b, flags: 0x0}, + 1005: {region: 0x96, script: 0x5b, flags: 0x0}, + 1006: {region: 0x9a, script: 0x5b, flags: 0x0}, + 1007: {region: 0x115, script: 0x5b, flags: 0x0}, + 1008: {region: 0x9a, script: 0xcf, flags: 0x0}, + 1009: {region: 0x166, script: 0x5b, flags: 0x0}, + 1010: {region: 0x166, script: 0x5b, flags: 0x0}, + 1011: {region: 0x130, script: 0x5b, flags: 0x0}, + 1012: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1013: {region: 0x9a, script: 0x22, flags: 0x0}, + 1014: {region: 0x166, script: 0x5, flags: 0x0}, + 1015: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1016: {region: 0x7c, script: 0x5b, flags: 0x0}, + 1017: {region: 0x49, script: 0x5b, flags: 0x0}, + 1018: {region: 0x33, script: 0x4, flags: 0x1}, + 1019: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1020: {region: 0x9d, script: 0x5, flags: 0x0}, + 1021: {region: 0xdb, script: 0x5b, flags: 0x0}, + 1022: {region: 0x4f, script: 0x5b, flags: 0x0}, + 1023: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1024: {region: 0xd0, script: 0x5b, flags: 0x0}, + 1025: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1026: {region: 0x4c, script: 0x5b, flags: 0x0}, + 1027: {region: 0x97, script: 0x80, flags: 0x0}, + 1028: {region: 0xb7, script: 0x5b, flags: 0x0}, + 1029: {region: 0x166, script: 0x2c, flags: 0x0}, + 1030: {region: 0x166, script: 0x5b, flags: 0x0}, + 1032: {region: 0xbb, script: 0xeb, flags: 0x0}, + 1033: {region: 0x166, script: 0x5b, flags: 0x0}, + 1034: {region: 0xc5, script: 0x76, flags: 0x0}, + 1035: {region: 0x166, script: 0x5, flags: 0x0}, + 1036: {region: 0xb4, script: 0xd6, flags: 0x0}, + 1037: {region: 0x70, script: 0x5b, flags: 0x0}, + 1038: {region: 0x166, script: 0x5b, flags: 0x0}, + 1039: {region: 0x166, script: 0x5b, flags: 0x0}, + 1040: {region: 0x166, script: 0x5b, flags: 0x0}, + 1041: {region: 0x166, script: 0x5b, flags: 0x0}, + 1042: {region: 0x112, script: 0x5b, flags: 0x0}, + 1043: {region: 0x166, script: 0x5b, flags: 0x0}, + 1044: {region: 0xe9, script: 0x5, flags: 0x0}, + 1045: {region: 0x166, script: 0x5b, flags: 0x0}, + 1046: {region: 0x110, script: 0x5b, flags: 0x0}, + 1047: {region: 0x166, script: 0x5b, flags: 0x0}, + 1048: {region: 0xea, script: 0x5b, flags: 0x0}, + 1049: {region: 0x166, script: 0x5b, flags: 0x0}, + 1050: {region: 0x96, script: 0x5b, flags: 0x0}, + 1051: {region: 0x143, script: 0x5b, flags: 0x0}, + 1052: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1054: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1055: {region: 0x73, script: 0x5b, flags: 0x0}, + 1056: {region: 0x98, script: 0xcc, flags: 0x0}, + 1057: {region: 0x166, script: 0x5b, flags: 0x0}, + 1058: {region: 0x73, script: 0x5b, flags: 0x0}, + 1059: {region: 0x165, script: 0x5b, flags: 0x0}, + 1060: {region: 0x166, script: 0x5b, flags: 0x0}, + 1061: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1062: {region: 0x166, script: 0x5b, flags: 0x0}, + 1063: {region: 0x166, script: 0x5b, flags: 0x0}, + 1064: {region: 0x166, script: 0x5b, flags: 0x0}, + 1065: {region: 0x116, script: 0x5b, flags: 0x0}, + 1066: {region: 0x166, script: 0x5b, flags: 0x0}, + 1067: {region: 0x166, script: 0x5b, flags: 0x0}, + 1068: {region: 0x124, script: 0xee, flags: 0x0}, + 1069: {region: 0x166, script: 0x5b, flags: 0x0}, + 1070: {region: 0x166, script: 0x5b, flags: 0x0}, + 1071: {region: 0x166, script: 0x5b, flags: 0x0}, + 1072: {region: 0x166, script: 0x5b, flags: 0x0}, + 1073: {region: 0x27, script: 0x5b, flags: 0x0}, + 1074: {region: 0x37, script: 0x5, flags: 0x1}, + 1075: {region: 0x9a, script: 0xd9, flags: 0x0}, + 1076: {region: 0x117, script: 0x5b, flags: 0x0}, + 1077: {region: 0x115, script: 0x5b, flags: 0x0}, + 1078: {region: 0x9a, script: 0x22, flags: 0x0}, + 1079: {region: 0x162, script: 0x5b, flags: 0x0}, + 1080: {region: 0x166, script: 0x5b, flags: 0x0}, + 1081: {region: 0x166, script: 0x5b, flags: 0x0}, + 1082: {region: 0x6e, script: 0x5b, flags: 0x0}, + 1083: {region: 0x162, script: 0x5b, flags: 0x0}, + 1084: {region: 0x166, script: 0x5b, flags: 0x0}, + 1085: {region: 0x61, script: 0x5b, flags: 0x0}, + 1086: {region: 0x96, script: 0x5b, flags: 0x0}, + 1087: {region: 0x166, script: 0x5b, flags: 0x0}, + 1088: {region: 0x166, script: 0x5b, flags: 0x0}, + 1089: {region: 0x130, script: 0x5b, flags: 0x0}, + 1090: {region: 0x166, script: 0x5b, flags: 0x0}, + 1091: {region: 0x85, script: 0x5b, flags: 0x0}, + 1092: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1093: {region: 0x130, script: 0x5b, flags: 0x0}, + 1094: {region: 0x160, script: 0x5, flags: 0x0}, + 1095: {region: 0x4b, script: 0x5b, flags: 0x0}, + 1096: {region: 0x61, script: 0x5b, flags: 0x0}, + 1097: {region: 0x166, script: 0x5b, flags: 0x0}, + 1098: {region: 0x9a, script: 0x22, flags: 0x0}, + 1099: {region: 0x96, script: 0x5b, flags: 0x0}, + 1100: {region: 0x166, script: 0x5b, flags: 0x0}, + 1101: {region: 0x35, script: 0xe, flags: 0x0}, + 1102: {region: 0x9c, script: 0xde, flags: 0x0}, + 1103: {region: 0xea, script: 0x5b, flags: 0x0}, + 1104: {region: 0x9a, script: 0xe6, flags: 0x0}, + 1105: {region: 0xdc, script: 0x22, flags: 0x0}, + 1106: {region: 0x166, script: 0x5b, flags: 0x0}, + 1107: {region: 0x166, script: 0x5b, flags: 0x0}, + 1108: {region: 0x166, script: 0x5b, flags: 0x0}, + 1109: {region: 0x166, script: 0x5b, flags: 0x0}, + 1110: {region: 0x166, script: 0x5b, flags: 0x0}, + 1111: {region: 0x166, script: 0x5b, flags: 0x0}, + 1112: {region: 0x166, script: 0x5b, flags: 0x0}, + 1113: {region: 0x166, script: 0x5b, flags: 0x0}, + 1114: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1115: {region: 0x166, script: 0x5b, flags: 0x0}, + 1116: {region: 0x166, script: 0x5b, flags: 0x0}, + 1117: {region: 0x9a, script: 0x53, flags: 0x0}, + 1118: {region: 0x53, script: 0xe4, flags: 0x0}, + 1119: {region: 0xdc, script: 0x22, flags: 0x0}, + 1120: {region: 0xdc, script: 0x22, flags: 0x0}, + 1121: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1122: {region: 0x166, script: 0x5b, flags: 0x0}, + 1123: {region: 0x113, script: 0x5b, flags: 0x0}, + 1124: {region: 0x132, script: 0x5b, flags: 0x0}, + 1125: {region: 0x127, script: 0x5b, flags: 0x0}, + 1126: {region: 0x166, script: 0x5b, flags: 0x0}, + 1127: {region: 0x3c, script: 0x3, flags: 0x1}, + 1128: {region: 0x166, script: 0x5b, flags: 0x0}, + 1129: {region: 0x166, script: 0x5b, flags: 0x0}, + 1130: {region: 0x166, script: 0x5b, flags: 0x0}, + 1131: {region: 0x124, script: 0xee, flags: 0x0}, + 1132: {region: 0xdc, script: 0x22, flags: 0x0}, + 1133: {region: 0xdc, script: 0x22, flags: 0x0}, + 1134: {region: 0xdc, script: 0x22, flags: 0x0}, + 1135: {region: 0x70, script: 0x2c, flags: 0x0}, + 1136: {region: 0x166, script: 0x5b, flags: 0x0}, + 1137: {region: 0x6e, script: 0x2c, flags: 0x0}, + 1138: {region: 0x166, script: 0x5b, flags: 0x0}, + 1139: {region: 0x166, script: 0x5b, flags: 0x0}, + 1140: {region: 0x166, script: 0x5b, flags: 0x0}, + 1141: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1142: {region: 0x128, script: 0x5b, flags: 0x0}, + 1143: {region: 0x126, script: 0x5b, flags: 0x0}, + 1144: {region: 0x32, script: 0x5b, flags: 0x0}, + 1145: {region: 0xdc, script: 0x22, flags: 0x0}, + 1146: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1147: {region: 0x166, script: 0x5b, flags: 0x0}, + 1148: {region: 0x166, script: 0x5b, flags: 0x0}, + 1149: {region: 0x32, script: 0x5b, flags: 0x0}, + 1150: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1151: {region: 0x166, script: 0x5b, flags: 0x0}, + 1152: {region: 0x162, script: 0x5b, flags: 0x0}, + 1153: {region: 0x166, script: 0x5b, flags: 0x0}, + 1154: {region: 0x12a, script: 0x5b, flags: 0x0}, + 1155: {region: 0x166, script: 0x5b, flags: 0x0}, + 1156: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1157: {region: 0x166, script: 0x5b, flags: 0x0}, + 1158: {region: 0xe7, script: 0x5b, flags: 0x0}, + 1159: {region: 0x166, script: 0x5b, flags: 0x0}, + 1160: {region: 0x166, script: 0x5b, flags: 0x0}, + 1161: {region: 0x166, script: 0x5b, flags: 0x0}, + 1162: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1163: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1164: {region: 0x12f, script: 0x5b, flags: 0x0}, + 1165: {region: 0x166, script: 0x5, flags: 0x0}, + 1166: {region: 0x162, script: 0x5b, flags: 0x0}, + 1167: {region: 0x88, script: 0x34, flags: 0x0}, + 1168: {region: 0xdc, script: 0x22, flags: 0x0}, + 1169: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1170: {region: 0x43, script: 0xef, flags: 0x0}, + 1171: {region: 0x166, script: 0x5b, flags: 0x0}, + 1172: {region: 0x107, script: 0x20, flags: 0x0}, + 1173: {region: 0x166, script: 0x5b, flags: 0x0}, + 1174: {region: 0x166, script: 0x5b, flags: 0x0}, + 1175: {region: 0x132, script: 0x5b, flags: 0x0}, + 1176: {region: 0x166, script: 0x5b, flags: 0x0}, + 1177: {region: 0x124, script: 0xee, flags: 0x0}, + 1178: {region: 0x32, script: 0x5b, flags: 0x0}, + 1179: {region: 0x166, script: 0x5b, flags: 0x0}, + 1180: {region: 0x166, script: 0x5b, flags: 0x0}, + 1181: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1182: {region: 0x166, script: 0x5b, flags: 0x0}, + 1183: {region: 0x166, script: 0x5b, flags: 0x0}, + 1184: {region: 0x12e, script: 0x5b, flags: 0x0}, + 1185: {region: 0x166, script: 0x5b, flags: 0x0}, + 1187: {region: 0x166, script: 0x5b, flags: 0x0}, + 1188: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1189: {region: 0x53, script: 0xe7, flags: 0x0}, + 1190: {region: 0xe6, script: 0x5b, flags: 0x0}, + 1191: {region: 0x166, script: 0x5b, flags: 0x0}, + 1192: {region: 0x107, script: 0x20, flags: 0x0}, + 1193: {region: 0xbb, script: 0x5b, flags: 0x0}, + 1194: {region: 0x166, script: 0x5b, flags: 0x0}, + 1195: {region: 0x107, script: 0x20, flags: 0x0}, + 1196: {region: 0x3f, script: 0x4, flags: 0x1}, + 1197: {region: 0x11d, script: 0xf3, flags: 0x0}, + 1198: {region: 0x131, script: 0x20, flags: 0x0}, + 1199: {region: 0x76, script: 0x5b, flags: 0x0}, + 1200: {region: 0x2a, script: 0x5b, flags: 0x0}, + 1202: {region: 0x43, script: 0x3, flags: 0x1}, + 1203: {region: 0x9a, script: 0xe, flags: 0x0}, + 1204: {region: 0xe9, script: 0x5, flags: 0x0}, + 1205: {region: 0x166, script: 0x5b, flags: 0x0}, + 1206: {region: 0x166, script: 0x5b, flags: 0x0}, + 1207: {region: 0x166, script: 0x5b, flags: 0x0}, + 1208: {region: 0x166, script: 0x5b, flags: 0x0}, + 1209: {region: 0x166, script: 0x5b, flags: 0x0}, + 1210: {region: 0x166, script: 0x5b, flags: 0x0}, + 1211: {region: 0x166, script: 0x5b, flags: 0x0}, + 1212: {region: 0x46, script: 0x4, flags: 0x1}, + 1213: {region: 0x166, script: 0x5b, flags: 0x0}, + 1214: {region: 0xb5, script: 0xf4, flags: 0x0}, + 1215: {region: 0x166, script: 0x5b, flags: 0x0}, + 1216: {region: 0x162, script: 0x5b, flags: 0x0}, + 1217: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1218: {region: 0x107, script: 0x5b, flags: 0x0}, + 1219: {region: 0x13f, script: 0x5b, flags: 0x0}, + 1220: {region: 0x11c, script: 0x5b, flags: 0x0}, + 1221: {region: 0x166, script: 0x5b, flags: 0x0}, + 1222: {region: 0x36, script: 0x5b, flags: 0x0}, + 1223: {region: 0x61, script: 0x5b, flags: 0x0}, + 1224: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1225: {region: 0x1, script: 0x5b, flags: 0x0}, + 1226: {region: 0x107, script: 0x5b, flags: 0x0}, + 1227: {region: 0x6b, script: 0x5b, flags: 0x0}, + 1228: {region: 0x130, script: 0x5b, flags: 0x0}, + 1229: {region: 0x166, script: 0x5b, flags: 0x0}, + 1230: {region: 0x36, script: 0x5b, flags: 0x0}, + 1231: {region: 0x4e, script: 0x5b, flags: 0x0}, + 1232: {region: 0x166, script: 0x5b, flags: 0x0}, + 1233: {region: 0x70, script: 0x2c, flags: 0x0}, + 1234: {region: 0x166, script: 0x5b, flags: 0x0}, + 1235: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1236: {region: 0x2f, script: 0x5b, flags: 0x0}, + 1237: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1238: {region: 0x9a, script: 0x22, flags: 0x0}, + 1239: {region: 0x166, script: 0x5b, flags: 0x0}, + 1240: {region: 0x166, script: 0x5b, flags: 0x0}, + 1241: {region: 0x166, script: 0x5b, flags: 0x0}, + 1242: {region: 0x166, script: 0x5b, flags: 0x0}, + 1243: {region: 0x166, script: 0x5b, flags: 0x0}, + 1244: {region: 0x166, script: 0x5b, flags: 0x0}, + 1245: {region: 0x166, script: 0x5b, flags: 0x0}, + 1246: {region: 0x166, script: 0x5b, flags: 0x0}, + 1247: {region: 0x166, script: 0x5b, flags: 0x0}, + 1248: {region: 0x141, script: 0x5b, flags: 0x0}, + 1249: {region: 0x166, script: 0x5b, flags: 0x0}, + 1250: {region: 0x166, script: 0x5b, flags: 0x0}, + 1251: {region: 0xa9, script: 0x5, flags: 0x0}, + 1252: {region: 0x166, script: 0x5b, flags: 0x0}, + 1253: {region: 0x115, script: 0x5b, flags: 0x0}, + 1254: {region: 0x166, script: 0x5b, flags: 0x0}, + 1255: {region: 0x166, script: 0x5b, flags: 0x0}, + 1256: {region: 0x166, script: 0x5b, flags: 0x0}, + 1257: {region: 0x166, script: 0x5b, flags: 0x0}, + 1258: {region: 0x9a, script: 0x22, flags: 0x0}, + 1259: {region: 0x53, script: 0x3b, flags: 0x0}, + 1260: {region: 0x166, script: 0x5b, flags: 0x0}, + 1261: {region: 0x166, script: 0x5b, flags: 0x0}, + 1262: {region: 0x41, script: 0x5b, flags: 0x0}, + 1263: {region: 0x166, script: 0x5b, flags: 0x0}, + 1264: {region: 0x12c, script: 0x18, flags: 0x0}, + 1265: {region: 0x166, script: 0x5b, flags: 0x0}, + 1266: {region: 0x162, script: 0x5b, flags: 0x0}, + 1267: {region: 0x166, script: 0x5b, flags: 0x0}, + 1268: {region: 0x12c, script: 0x63, flags: 0x0}, + 1269: {region: 0x12c, script: 0x64, flags: 0x0}, + 1270: {region: 0x7e, script: 0x2e, flags: 0x0}, + 1271: {region: 0x53, script: 0x68, flags: 0x0}, + 1272: {region: 0x10c, script: 0x6d, flags: 0x0}, + 1273: {region: 0x109, script: 0x79, flags: 0x0}, + 1274: {region: 0x9a, script: 0x22, flags: 0x0}, + 1275: {region: 0x132, script: 0x5b, flags: 0x0}, + 1276: {region: 0x166, script: 0x5b, flags: 0x0}, + 1277: {region: 0x9d, script: 0x93, flags: 0x0}, + 1278: {region: 0x166, script: 0x5b, flags: 0x0}, + 1279: {region: 0x15f, script: 0xce, flags: 0x0}, + 1280: {region: 0x166, script: 0x5b, flags: 0x0}, + 1281: {region: 0x166, script: 0x5b, flags: 0x0}, + 1282: {region: 0xdc, script: 0x22, flags: 0x0}, + 1283: {region: 0x166, script: 0x5b, flags: 0x0}, + 1284: {region: 0x166, script: 0x5b, flags: 0x0}, + 1285: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1286: {region: 0x76, script: 0x5b, flags: 0x0}, + 1287: {region: 0x166, script: 0x5b, flags: 0x0}, + 1288: {region: 0x166, script: 0x5b, flags: 0x0}, + 1289: {region: 0x52, script: 0x5b, flags: 0x0}, + 1290: {region: 0x166, script: 0x5b, flags: 0x0}, + 1291: {region: 0x166, script: 0x5b, flags: 0x0}, + 1292: {region: 0x166, script: 0x5b, flags: 0x0}, + 1293: {region: 0x52, script: 0x5b, flags: 0x0}, + 1294: {region: 0x166, script: 0x5b, flags: 0x0}, + 1295: {region: 0x166, script: 0x5b, flags: 0x0}, + 1296: {region: 0x166, script: 0x5b, flags: 0x0}, + 1297: {region: 0x166, script: 0x5b, flags: 0x0}, + 1298: {region: 0x1, script: 0x3e, flags: 0x0}, + 1299: {region: 0x166, script: 0x5b, flags: 0x0}, + 1300: {region: 0x166, script: 0x5b, flags: 0x0}, + 1301: {region: 0x166, script: 0x5b, flags: 0x0}, + 1302: {region: 0x166, script: 0x5b, flags: 0x0}, + 1303: {region: 0x166, script: 0x5b, flags: 0x0}, + 1304: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1305: {region: 0x166, script: 0x5b, flags: 0x0}, + 1306: {region: 0x166, script: 0x5b, flags: 0x0}, + 1307: {region: 0x166, script: 0x5b, flags: 0x0}, + 1308: {region: 0x41, script: 0x5b, flags: 0x0}, + 1309: {region: 0x166, script: 0x5b, flags: 0x0}, + 1310: {region: 0xd0, script: 0x5b, flags: 0x0}, + 1311: {region: 0x4a, script: 0x3, flags: 0x1}, + 1312: {region: 0x166, script: 0x5b, flags: 0x0}, + 1313: {region: 0x166, script: 0x5b, flags: 0x0}, + 1314: {region: 0x166, script: 0x5b, flags: 0x0}, + 1315: {region: 0x53, script: 0x5b, flags: 0x0}, + 1316: {region: 0x10c, script: 0x5b, flags: 0x0}, + 1318: {region: 0xa9, script: 0x5, flags: 0x0}, + 1319: {region: 0xda, script: 0x5b, flags: 0x0}, + 1320: {region: 0xbb, script: 0xeb, flags: 0x0}, + 1321: {region: 0x4d, script: 0x14, flags: 0x1}, + 1322: {region: 0x53, script: 0x7f, flags: 0x0}, + 1323: {region: 0x166, script: 0x5b, flags: 0x0}, + 1324: {region: 0x123, script: 0x5b, flags: 0x0}, + 1325: {region: 0xd1, script: 0x5b, flags: 0x0}, + 1326: {region: 0x166, script: 0x5b, flags: 0x0}, + 1327: {region: 0x162, script: 0x5b, flags: 0x0}, + 1329: {region: 0x12c, script: 0x5b, flags: 0x0}, +} + +// likelyLangList holds lists info associated with likelyLang. +// Size: 582 bytes, 97 elements +var likelyLangList = [97]likelyScriptRegion{ + 0: {region: 0x9d, script: 0x7, flags: 0x0}, + 1: {region: 0xa2, script: 0x7a, flags: 0x2}, + 2: {region: 0x11d, script: 0x87, flags: 0x2}, + 3: {region: 0x32, script: 0x5b, flags: 0x0}, + 4: {region: 0x9c, script: 0x5, flags: 0x4}, + 5: {region: 0x9d, script: 0x5, flags: 0x4}, + 6: {region: 0x107, script: 0x20, flags: 0x4}, + 7: {region: 0x9d, script: 0x5, flags: 0x2}, + 8: {region: 0x107, script: 0x20, flags: 0x0}, + 9: {region: 0x38, script: 0x2f, flags: 0x2}, + 10: {region: 0x136, script: 0x5b, flags: 0x0}, + 11: {region: 0x7c, script: 0xd1, flags: 0x2}, + 12: {region: 0x115, script: 0x5b, flags: 0x0}, + 13: {region: 0x85, script: 0x1, flags: 0x2}, + 14: {region: 0x5e, script: 0x1f, flags: 0x0}, + 15: {region: 0x88, script: 0x60, flags: 0x2}, + 16: {region: 0xd7, script: 0x5b, flags: 0x0}, + 17: {region: 0x52, script: 0x5, flags: 0x4}, + 18: {region: 0x10c, script: 0x5, flags: 0x4}, + 19: {region: 0xaf, script: 0x20, flags: 0x0}, + 20: {region: 0x24, script: 0x5, flags: 0x4}, + 21: {region: 0x53, script: 0x5, flags: 0x4}, + 22: {region: 0x9d, script: 0x5, flags: 0x4}, + 23: {region: 0xc6, script: 0x5, flags: 0x4}, + 24: {region: 0x53, script: 0x5, flags: 0x2}, + 25: {region: 0x12c, script: 0x5b, flags: 0x0}, + 26: {region: 0xb1, script: 0x5, flags: 0x4}, + 27: {region: 0x9c, script: 0x5, flags: 0x2}, + 28: {region: 0xa6, script: 0x20, flags: 0x0}, + 29: {region: 0x53, script: 0x5, flags: 0x4}, + 30: {region: 0x12c, script: 0x5b, flags: 0x4}, + 31: {region: 0x53, script: 0x5, flags: 0x2}, + 32: {region: 0x12c, script: 0x5b, flags: 0x2}, + 33: {region: 0xdc, script: 0x22, flags: 0x0}, + 34: {region: 0x9a, script: 0x5e, flags: 0x2}, + 35: {region: 0x84, script: 0x5b, flags: 0x0}, + 36: {region: 0x85, script: 0x7e, flags: 0x4}, + 37: {region: 0x85, script: 0x7e, flags: 0x2}, + 38: {region: 0xc6, script: 0x20, flags: 0x0}, + 39: {region: 0x53, script: 0x71, flags: 0x4}, + 40: {region: 0x53, script: 0x71, flags: 0x2}, + 41: {region: 0xd1, script: 0x5b, flags: 0x0}, + 42: {region: 0x4a, script: 0x5, flags: 0x4}, + 43: {region: 0x96, script: 0x5, flags: 0x4}, + 44: {region: 0x9a, script: 0x36, flags: 0x0}, + 45: {region: 0xe9, script: 0x5, flags: 0x4}, + 46: {region: 0xe9, script: 0x5, flags: 0x2}, + 47: {region: 0x9d, script: 0x8d, flags: 0x0}, + 48: {region: 0x53, script: 0x8e, flags: 0x2}, + 49: {region: 0xbb, script: 0xeb, flags: 0x0}, + 50: {region: 0xda, script: 0x5b, flags: 0x4}, + 51: {region: 0xe9, script: 0x5, flags: 0x0}, + 52: {region: 0x9a, script: 0x22, flags: 0x2}, + 53: {region: 0x9a, script: 0x50, flags: 0x2}, + 54: {region: 0x9a, script: 0xd5, flags: 0x2}, + 55: {region: 0x106, script: 0x20, flags: 0x0}, + 56: {region: 0xbe, script: 0x5b, flags: 0x4}, + 57: {region: 0x105, script: 0x5b, flags: 0x4}, + 58: {region: 0x107, script: 0x5b, flags: 0x4}, + 59: {region: 0x12c, script: 0x5b, flags: 0x4}, + 60: {region: 0x125, script: 0x20, flags: 0x0}, + 61: {region: 0xe9, script: 0x5, flags: 0x4}, + 62: {region: 0xe9, script: 0x5, flags: 0x2}, + 63: {region: 0x53, script: 0x5, flags: 0x0}, + 64: {region: 0xaf, script: 0x20, flags: 0x4}, + 65: {region: 0xc6, script: 0x20, flags: 0x4}, + 66: {region: 0xaf, script: 0x20, flags: 0x2}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0xdc, script: 0x22, flags: 0x4}, + 69: {region: 0xdc, script: 0x22, flags: 0x2}, + 70: {region: 0x138, script: 0x5b, flags: 0x0}, + 71: {region: 0x24, script: 0x5, flags: 0x4}, + 72: {region: 0x53, script: 0x20, flags: 0x4}, + 73: {region: 0x24, script: 0x5, flags: 0x2}, + 74: {region: 0x8e, script: 0x3c, flags: 0x0}, + 75: {region: 0x53, script: 0x3b, flags: 0x4}, + 76: {region: 0x53, script: 0x3b, flags: 0x2}, + 77: {region: 0x53, script: 0x3b, flags: 0x0}, + 78: {region: 0x2f, script: 0x3c, flags: 0x4}, + 79: {region: 0x3e, script: 0x3c, flags: 0x4}, + 80: {region: 0x7c, script: 0x3c, flags: 0x4}, + 81: {region: 0x7f, script: 0x3c, flags: 0x4}, + 82: {region: 0x8e, script: 0x3c, flags: 0x4}, + 83: {region: 0x96, script: 0x3c, flags: 0x4}, + 84: {region: 0xc7, script: 0x3c, flags: 0x4}, + 85: {region: 0xd1, script: 0x3c, flags: 0x4}, + 86: {region: 0xe3, script: 0x3c, flags: 0x4}, + 87: {region: 0xe6, script: 0x3c, flags: 0x4}, + 88: {region: 0xe8, script: 0x3c, flags: 0x4}, + 89: {region: 0x117, script: 0x3c, flags: 0x4}, + 90: {region: 0x124, script: 0x3c, flags: 0x4}, + 91: {region: 0x12f, script: 0x3c, flags: 0x4}, + 92: {region: 0x136, script: 0x3c, flags: 0x4}, + 93: {region: 0x13f, script: 0x3c, flags: 0x4}, + 94: {region: 0x12f, script: 0x11, flags: 0x2}, + 95: {region: 0x12f, script: 0x37, flags: 0x2}, + 96: {region: 0x12f, script: 0x3c, flags: 0x2}, +} + +type likelyLangScript struct { + lang uint16 + script uint16 + flags uint8 +} + +// likelyRegion is a lookup table, indexed by regionID, for the most likely +// languages and scripts given incomplete information. If more entries exist +// for a given regionID, lang and script are the index and size respectively +// of the list in likelyRegionList. +// TODO: exclude containers and user-definable regions from the list. +// Size: 2154 bytes, 359 elements +var likelyRegion = [359]likelyLangScript{ + 34: {lang: 0xd7, script: 0x5b, flags: 0x0}, + 35: {lang: 0x3a, script: 0x5, flags: 0x0}, + 36: {lang: 0x0, script: 0x2, flags: 0x1}, + 39: {lang: 0x2, script: 0x2, flags: 0x1}, + 40: {lang: 0x4, script: 0x2, flags: 0x1}, + 42: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 43: {lang: 0x0, script: 0x5b, flags: 0x0}, + 44: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 45: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 46: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 48: {lang: 0x367, script: 0x5b, flags: 0x0}, + 49: {lang: 0x444, script: 0x5b, flags: 0x0}, + 50: {lang: 0x58, script: 0x5b, flags: 0x0}, + 51: {lang: 0x6, script: 0x2, flags: 0x1}, + 53: {lang: 0xa5, script: 0xe, flags: 0x0}, + 54: {lang: 0x367, script: 0x5b, flags: 0x0}, + 55: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 56: {lang: 0x7e, script: 0x20, flags: 0x0}, + 57: {lang: 0x3a, script: 0x5, flags: 0x0}, + 58: {lang: 0x3d9, script: 0x5b, flags: 0x0}, + 59: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 60: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 62: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 63: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 64: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 65: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 67: {lang: 0x8, script: 0x2, flags: 0x1}, + 69: {lang: 0x0, script: 0x5b, flags: 0x0}, + 71: {lang: 0x71, script: 0x20, flags: 0x0}, + 73: {lang: 0x512, script: 0x3e, flags: 0x2}, + 74: {lang: 0x31f, script: 0x5, flags: 0x2}, + 75: {lang: 0x445, script: 0x5b, flags: 0x0}, + 76: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 77: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 78: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 81: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 82: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 83: {lang: 0xa, script: 0x4, flags: 0x1}, + 84: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 85: {lang: 0x0, script: 0x5b, flags: 0x0}, + 87: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 90: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 91: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 92: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 94: {lang: 0xe, script: 0x2, flags: 0x1}, + 95: {lang: 0xfa, script: 0x5b, flags: 0x0}, + 97: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 99: {lang: 0x1, script: 0x5b, flags: 0x0}, + 100: {lang: 0x101, script: 0x5b, flags: 0x0}, + 102: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 104: {lang: 0x10, script: 0x2, flags: 0x1}, + 105: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 106: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 107: {lang: 0x140, script: 0x5b, flags: 0x0}, + 108: {lang: 0x3a, script: 0x5, flags: 0x0}, + 109: {lang: 0x3a, script: 0x5, flags: 0x0}, + 110: {lang: 0x46f, script: 0x2c, flags: 0x0}, + 111: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 112: {lang: 0x12, script: 0x2, flags: 0x1}, + 114: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 115: {lang: 0x151, script: 0x5b, flags: 0x0}, + 116: {lang: 0x1c0, script: 0x22, flags: 0x2}, + 119: {lang: 0x158, script: 0x5b, flags: 0x0}, + 121: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 123: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 124: {lang: 0x14, script: 0x2, flags: 0x1}, + 126: {lang: 0x16, script: 0x3, flags: 0x1}, + 127: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 129: {lang: 0x21, script: 0x5b, flags: 0x0}, + 131: {lang: 0x245, script: 0x5b, flags: 0x0}, + 133: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 134: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 135: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 136: {lang: 0x19, script: 0x2, flags: 0x1}, + 137: {lang: 0x0, script: 0x5b, flags: 0x0}, + 138: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 140: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 142: {lang: 0x529, script: 0x3c, flags: 0x0}, + 143: {lang: 0x0, script: 0x5b, flags: 0x0}, + 144: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 145: {lang: 0x1d1, script: 0x5b, flags: 0x0}, + 146: {lang: 0x1d4, script: 0x5b, flags: 0x0}, + 147: {lang: 0x1d5, script: 0x5b, flags: 0x0}, + 149: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 150: {lang: 0x1b, script: 0x2, flags: 0x1}, + 152: {lang: 0x1bc, script: 0x3e, flags: 0x0}, + 154: {lang: 0x1d, script: 0x3, flags: 0x1}, + 156: {lang: 0x3a, script: 0x5, flags: 0x0}, + 157: {lang: 0x20, script: 0x2, flags: 0x1}, + 158: {lang: 0x1f8, script: 0x5b, flags: 0x0}, + 159: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 162: {lang: 0x3a, script: 0x5, flags: 0x0}, + 163: {lang: 0x200, script: 0x49, flags: 0x0}, + 165: {lang: 0x445, script: 0x5b, flags: 0x0}, + 166: {lang: 0x28a, script: 0x20, flags: 0x0}, + 167: {lang: 0x22, script: 0x3, flags: 0x1}, + 169: {lang: 0x25, script: 0x2, flags: 0x1}, + 171: {lang: 0x254, script: 0x54, flags: 0x0}, + 172: {lang: 0x254, script: 0x54, flags: 0x0}, + 173: {lang: 0x3a, script: 0x5, flags: 0x0}, + 175: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 176: {lang: 0x27, script: 0x2, flags: 0x1}, + 177: {lang: 0x3a, script: 0x5, flags: 0x0}, + 179: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 180: {lang: 0x40c, script: 0xd6, flags: 0x0}, + 182: {lang: 0x43b, script: 0x5b, flags: 0x0}, + 183: {lang: 0x2c0, script: 0x5b, flags: 0x0}, + 184: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 185: {lang: 0x2c7, script: 0x5b, flags: 0x0}, + 186: {lang: 0x3a, script: 0x5, flags: 0x0}, + 187: {lang: 0x29, script: 0x2, flags: 0x1}, + 188: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 189: {lang: 0x2b, script: 0x2, flags: 0x1}, + 190: {lang: 0x432, script: 0x5b, flags: 0x0}, + 191: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 192: {lang: 0x2f1, script: 0x5b, flags: 0x0}, + 195: {lang: 0x2d, script: 0x2, flags: 0x1}, + 196: {lang: 0xa0, script: 0x5b, flags: 0x0}, + 197: {lang: 0x2f, script: 0x2, flags: 0x1}, + 198: {lang: 0x31, script: 0x2, flags: 0x1}, + 199: {lang: 0x33, script: 0x2, flags: 0x1}, + 201: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 202: {lang: 0x35, script: 0x2, flags: 0x1}, + 204: {lang: 0x320, script: 0x5b, flags: 0x0}, + 205: {lang: 0x37, script: 0x3, flags: 0x1}, + 206: {lang: 0x128, script: 0xed, flags: 0x0}, + 208: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 209: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 210: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 211: {lang: 0x16, script: 0x5b, flags: 0x0}, + 212: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 213: {lang: 0x1b4, script: 0x5b, flags: 0x0}, + 215: {lang: 0x1b4, script: 0x5, flags: 0x2}, + 217: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 218: {lang: 0x367, script: 0x5b, flags: 0x0}, + 219: {lang: 0x347, script: 0x5b, flags: 0x0}, + 220: {lang: 0x351, script: 0x22, flags: 0x0}, + 226: {lang: 0x3a, script: 0x5, flags: 0x0}, + 227: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 229: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 230: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 231: {lang: 0x486, script: 0x5b, flags: 0x0}, + 232: {lang: 0x153, script: 0x5b, flags: 0x0}, + 233: {lang: 0x3a, script: 0x3, flags: 0x1}, + 234: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 235: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 237: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 238: {lang: 0x3a, script: 0x5, flags: 0x0}, + 239: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 241: {lang: 0x3a2, script: 0x5b, flags: 0x0}, + 242: {lang: 0x194, script: 0x5b, flags: 0x0}, + 244: {lang: 0x3a, script: 0x5, flags: 0x0}, + 259: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 261: {lang: 0x3d, script: 0x2, flags: 0x1}, + 262: {lang: 0x432, script: 0x20, flags: 0x0}, + 263: {lang: 0x3f, script: 0x2, flags: 0x1}, + 264: {lang: 0x3e5, script: 0x5b, flags: 0x0}, + 265: {lang: 0x3a, script: 0x5, flags: 0x0}, + 267: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 268: {lang: 0x3a, script: 0x5, flags: 0x0}, + 269: {lang: 0x41, script: 0x2, flags: 0x1}, + 272: {lang: 0x416, script: 0x5b, flags: 0x0}, + 273: {lang: 0x347, script: 0x5b, flags: 0x0}, + 274: {lang: 0x43, script: 0x2, flags: 0x1}, + 276: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 277: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 278: {lang: 0x429, script: 0x5b, flags: 0x0}, + 279: {lang: 0x367, script: 0x5b, flags: 0x0}, + 281: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 283: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 285: {lang: 0x45, script: 0x2, flags: 0x1}, + 289: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 290: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 291: {lang: 0x47, script: 0x2, flags: 0x1}, + 292: {lang: 0x49, script: 0x3, flags: 0x1}, + 293: {lang: 0x4c, script: 0x2, flags: 0x1}, + 294: {lang: 0x477, script: 0x5b, flags: 0x0}, + 295: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 296: {lang: 0x476, script: 0x5b, flags: 0x0}, + 297: {lang: 0x4e, script: 0x2, flags: 0x1}, + 298: {lang: 0x482, script: 0x5b, flags: 0x0}, + 300: {lang: 0x50, script: 0x4, flags: 0x1}, + 302: {lang: 0x4a0, script: 0x5b, flags: 0x0}, + 303: {lang: 0x54, script: 0x2, flags: 0x1}, + 304: {lang: 0x445, script: 0x5b, flags: 0x0}, + 305: {lang: 0x56, script: 0x3, flags: 0x1}, + 306: {lang: 0x445, script: 0x5b, flags: 0x0}, + 310: {lang: 0x512, script: 0x3e, flags: 0x2}, + 311: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 312: {lang: 0x4bc, script: 0x5b, flags: 0x0}, + 313: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 316: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 319: {lang: 0x4c3, script: 0x5b, flags: 0x0}, + 320: {lang: 0x8a, script: 0x5b, flags: 0x0}, + 321: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 323: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 334: {lang: 0x59, script: 0x2, flags: 0x1}, + 351: {lang: 0x3a, script: 0x5, flags: 0x0}, + 352: {lang: 0x5b, script: 0x2, flags: 0x1}, + 357: {lang: 0x423, script: 0x5b, flags: 0x0}, +} + +// likelyRegionList holds lists info associated with likelyRegion. +// Size: 558 bytes, 93 elements +var likelyRegionList = [93]likelyLangScript{ + 0: {lang: 0x148, script: 0x5, flags: 0x0}, + 1: {lang: 0x476, script: 0x5b, flags: 0x0}, + 2: {lang: 0x431, script: 0x5b, flags: 0x0}, + 3: {lang: 0x2ff, script: 0x20, flags: 0x0}, + 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, + 5: {lang: 0x274, script: 0x5b, flags: 0x0}, + 6: {lang: 0xb7, script: 0x5b, flags: 0x0}, + 7: {lang: 0x432, script: 0x20, flags: 0x0}, + 8: {lang: 0x12d, script: 0xef, flags: 0x0}, + 9: {lang: 0x351, script: 0x22, flags: 0x0}, + 10: {lang: 0x529, script: 0x3b, flags: 0x0}, + 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, + 12: {lang: 0x523, script: 0x5b, flags: 0x0}, + 13: {lang: 0x29a, script: 0xee, flags: 0x0}, + 14: {lang: 0x136, script: 0x34, flags: 0x0}, + 15: {lang: 0x48a, script: 0x5b, flags: 0x0}, + 16: {lang: 0x3a, script: 0x5, flags: 0x0}, + 17: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 18: {lang: 0x27, script: 0x2c, flags: 0x0}, + 19: {lang: 0x139, script: 0x5b, flags: 0x0}, + 20: {lang: 0x26a, script: 0x5, flags: 0x2}, + 21: {lang: 0x512, script: 0x3e, flags: 0x2}, + 22: {lang: 0x210, script: 0x2e, flags: 0x0}, + 23: {lang: 0x5, script: 0x20, flags: 0x0}, + 24: {lang: 0x274, script: 0x5b, flags: 0x0}, + 25: {lang: 0x136, script: 0x34, flags: 0x0}, + 26: {lang: 0x2ff, script: 0x20, flags: 0x0}, + 27: {lang: 0x1e1, script: 0x5b, flags: 0x0}, + 28: {lang: 0x31f, script: 0x5, flags: 0x0}, + 29: {lang: 0x1be, script: 0x22, flags: 0x0}, + 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 31: {lang: 0x236, script: 0x76, flags: 0x0}, + 32: {lang: 0x148, script: 0x5, flags: 0x0}, + 33: {lang: 0x476, script: 0x5b, flags: 0x0}, + 34: {lang: 0x24a, script: 0x4f, flags: 0x0}, + 35: {lang: 0xe6, script: 0x5, flags: 0x0}, + 36: {lang: 0x226, script: 0xee, flags: 0x0}, + 37: {lang: 0x3a, script: 0x5, flags: 0x0}, + 38: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 39: {lang: 0x2b8, script: 0x58, flags: 0x0}, + 40: {lang: 0x226, script: 0xee, flags: 0x0}, + 41: {lang: 0x3a, script: 0x5, flags: 0x0}, + 42: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 43: {lang: 0x3dc, script: 0x5b, flags: 0x0}, + 44: {lang: 0x4ae, script: 0x20, flags: 0x0}, + 45: {lang: 0x2ff, script: 0x20, flags: 0x0}, + 46: {lang: 0x431, script: 0x5b, flags: 0x0}, + 47: {lang: 0x331, script: 0x76, flags: 0x0}, + 48: {lang: 0x213, script: 0x5b, flags: 0x0}, + 49: {lang: 0x30b, script: 0x20, flags: 0x0}, + 50: {lang: 0x242, script: 0x5, flags: 0x0}, + 51: {lang: 0x529, script: 0x3c, flags: 0x0}, + 52: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 53: {lang: 0x3a, script: 0x5, flags: 0x0}, + 54: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 55: {lang: 0x2ed, script: 0x5b, flags: 0x0}, + 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 57: {lang: 0x88, script: 0x22, flags: 0x0}, + 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 60: {lang: 0xbe, script: 0x22, flags: 0x0}, + 61: {lang: 0x3dc, script: 0x5b, flags: 0x0}, + 62: {lang: 0x7e, script: 0x20, flags: 0x0}, + 63: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 64: {lang: 0x267, script: 0x5b, flags: 0x0}, + 65: {lang: 0x444, script: 0x5b, flags: 0x0}, + 66: {lang: 0x512, script: 0x3e, flags: 0x0}, + 67: {lang: 0x412, script: 0x5b, flags: 0x0}, + 68: {lang: 0x4ae, script: 0x20, flags: 0x0}, + 69: {lang: 0x3a, script: 0x5, flags: 0x0}, + 70: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 71: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 72: {lang: 0x35, script: 0x5, flags: 0x0}, + 73: {lang: 0x46b, script: 0xee, flags: 0x0}, + 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, + 75: {lang: 0x30f, script: 0x76, flags: 0x0}, + 76: {lang: 0x467, script: 0x20, flags: 0x0}, + 77: {lang: 0x148, script: 0x5, flags: 0x0}, + 78: {lang: 0x3a, script: 0x5, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 80: {lang: 0x48a, script: 0x5b, flags: 0x0}, + 81: {lang: 0x58, script: 0x5, flags: 0x0}, + 82: {lang: 0x219, script: 0x20, flags: 0x0}, + 83: {lang: 0x81, script: 0x34, flags: 0x0}, + 84: {lang: 0x529, script: 0x3c, flags: 0x0}, + 85: {lang: 0x48c, script: 0x5b, flags: 0x0}, + 86: {lang: 0x4ae, script: 0x20, flags: 0x0}, + 87: {lang: 0x512, script: 0x3e, flags: 0x0}, + 88: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 89: {lang: 0x431, script: 0x5b, flags: 0x0}, + 90: {lang: 0x432, script: 0x20, flags: 0x0}, + 91: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 92: {lang: 0x446, script: 0x5, flags: 0x0}, +} + +type likelyTag struct { + lang uint16 + region uint16 + script uint16 +} + +// Size: 198 bytes, 33 elements +var likelyRegionGroup = [33]likelyTag{ + 1: {lang: 0x139, region: 0xd7, script: 0x5b}, + 2: {lang: 0x139, region: 0x136, script: 0x5b}, + 3: {lang: 0x3c0, region: 0x41, script: 0x5b}, + 4: {lang: 0x139, region: 0x2f, script: 0x5b}, + 5: {lang: 0x139, region: 0xd7, script: 0x5b}, + 6: {lang: 0x13e, region: 0xd0, script: 0x5b}, + 7: {lang: 0x445, region: 0x130, script: 0x5b}, + 8: {lang: 0x3a, region: 0x6c, script: 0x5}, + 9: {lang: 0x445, region: 0x4b, script: 0x5b}, + 10: {lang: 0x139, region: 0x162, script: 0x5b}, + 11: {lang: 0x139, region: 0x136, script: 0x5b}, + 12: {lang: 0x139, region: 0x136, script: 0x5b}, + 13: {lang: 0x13e, region: 0x5a, script: 0x5b}, + 14: {lang: 0x529, region: 0x53, script: 0x3b}, + 15: {lang: 0x1be, region: 0x9a, script: 0x22}, + 16: {lang: 0x1e1, region: 0x96, script: 0x5b}, + 17: {lang: 0x1f9, region: 0x9f, script: 0x5b}, + 18: {lang: 0x139, region: 0x2f, script: 0x5b}, + 19: {lang: 0x139, region: 0xe7, script: 0x5b}, + 20: {lang: 0x139, region: 0x8b, script: 0x5b}, + 21: {lang: 0x41b, region: 0x143, script: 0x5b}, + 22: {lang: 0x529, region: 0x53, script: 0x3b}, + 23: {lang: 0x4bc, region: 0x138, script: 0x5b}, + 24: {lang: 0x3a, region: 0x109, script: 0x5}, + 25: {lang: 0x3e2, region: 0x107, script: 0x20}, + 26: {lang: 0x3e2, region: 0x107, script: 0x20}, + 27: {lang: 0x139, region: 0x7c, script: 0x5b}, + 28: {lang: 0x10d, region: 0x61, script: 0x5b}, + 29: {lang: 0x139, region: 0xd7, script: 0x5b}, + 30: {lang: 0x13e, region: 0x1f, script: 0x5b}, + 31: {lang: 0x139, region: 0x9b, script: 0x5b}, + 32: {lang: 0x139, region: 0x7c, script: 0x5b}, +} + +// Size: 264 bytes, 33 elements +var regionContainment = [33]uint64{ + // Entry 0 - 1F + 0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008, + 0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080, + 0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c, + 0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000, + 0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000, + 0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000, + 0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000, + 0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000, + // Entry 20 - 3F + 0x0000000100000000, +} + +// regionInclusion maps region identifiers to sets of regions in regionInclusionBits, +// where each set holds all groupings that are directly connected in a region +// containment graph. +// Size: 359 bytes, 359 elements +var regionInclusion = [359]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, + 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, + 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16, + 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e, + 0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23, + 0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b, + 0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d, + 0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28, + // Entry 40 - 7F + 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, + 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, + 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x21, 0x34, + 0x23, 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, + 0x35, 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, + 0x39, 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, + 0x2f, 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, + 0x21, 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, + // Entry 80 - BF + 0x2c, 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, + 0x3a, 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, + 0x34, 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, + 0x24, 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, + 0x2c, 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, + 0x3c, 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, + 0x31, 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, + 0x2a, 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, + // Entry C0 - FF + 0x2f, 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, + 0x3c, 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, + 0x34, 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, + 0x21, 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, + 0x29, 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, + 0x31, 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, + 0x21, 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + // Entry 100 - 13F + 0x21, 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, + 0x2f, 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, + 0x3a, 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, + 0x2f, 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, + 0x26, 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, + 0x3d, 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, + 0x2f, 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, + 0x3d, 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, + // Entry 140 - 17F + 0x3b, 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, + 0x2f, 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, +} + +// regionInclusionBits is an array of bit vectors where every vector represents +// a set of region groupings. These sets are used to compute the distance +// between two regions for the purpose of language matching. +// Size: 584 bytes, 73 elements +var regionInclusionBits = [73]uint64{ + // Entry 0 - 1F + 0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808, + 0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082, + 0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d, + 0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000, + 0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010, + 0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000, + 0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000, + 0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010, + // Entry 20 - 3F + 0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000, + 0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200, + 0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000, + 0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080, + 0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000, + 0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000, + 0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000, + 0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3, + // Entry 40 - 5F + 0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813, + 0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001, + 0x0000000102020001, +} + +// regionInclusionNext marks, for each entry in regionInclusionBits, the set of +// all groups that are reachable from the groups set in the respective entry. +// Size: 73 bytes, 73 elements +var regionInclusionNext = [73]uint8{ + // Entry 0 - 3F + 0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01, + 0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16, + 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16, + 0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04, + 0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09, + 0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07, + 0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46, + 0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e, + // Entry 40 - 7F + 0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43, + 0x43, +} + +type parentRel struct { + lang uint16 + script uint16 + maxScript uint16 + toRegion uint16 + fromRegion []uint16 +} + +// Size: 414 bytes, 5 elements +var parents = [5]parentRel{ + 0: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5d, 0x5e, 0x62, 0x65, 0x6e, 0x74, 0x75, 0x76, 0x7c, 0x7d, 0x80, 0x81, 0x82, 0x84, 0x8d, 0x8e, 0x97, 0x98, 0x99, 0x9a, 0x9b, 0xa0, 0xa1, 0xa5, 0xa8, 0xaa, 0xae, 0xb2, 0xb5, 0xb6, 0xc0, 0xc7, 0xcb, 0xcc, 0xcd, 0xcf, 0xd1, 0xd3, 0xd6, 0xd7, 0xde, 0xe0, 0xe1, 0xe7, 0xe8, 0xe9, 0xec, 0xf1, 0x108, 0x10a, 0x10b, 0x10c, 0x10e, 0x10f, 0x113, 0x118, 0x11c, 0x11e, 0x120, 0x126, 0x12a, 0x12d, 0x12e, 0x130, 0x132, 0x13a, 0x13d, 0x140, 0x143, 0x162, 0x163, 0x165}}, + 1: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x61, 0x64, 0x73, 0xda, 0x10d, 0x110}}, + 2: {lang: 0x13e, script: 0x0, maxScript: 0x5b, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x57, 0x5a, 0x66, 0x6a, 0x8a, 0x90, 0xd0, 0xd9, 0xe3, 0xe5, 0xed, 0xf2, 0x11b, 0x136, 0x137, 0x13c}}, + 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5b, toRegion: 0xef, fromRegion: []uint16{0x2a, 0x4e, 0x5b, 0x87, 0x8c, 0xb8, 0xc7, 0xd2, 0x119, 0x127}}, + 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8e, fromRegion: []uint16{0xc7}}, +} + +// Total table size 30466 bytes (29KiB); checksum: 7544152B diff --git a/vendor/golang.org/x/text/internal/language/tags.go b/vendor/golang.org/x/text/internal/language/tags.go new file mode 100644 index 0000000..e7afd31 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/tags.go @@ -0,0 +1,48 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func MustParse(s string) Tag { + t, err := Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. +// It simplifies safe initialization of Base values. +func MustParseBase(s string) Language { + b, err := ParseBase(s) + if err != nil { + panic(err) + } + return b +} + +// MustParseScript is like ParseScript, but panics if the given script cannot be +// parsed. It simplifies safe initialization of Script values. +func MustParseScript(s string) Script { + scr, err := ParseScript(s) + if err != nil { + panic(err) + } + return scr +} + +// MustParseRegion is like ParseRegion, but panics if the given region cannot be +// parsed. It simplifies safe initialization of Region values. +func MustParseRegion(s string) Region { + r, err := ParseRegion(s) + if err != nil { + panic(err) + } + return r +} + +// Und is the root language. +var Und Tag diff --git a/vendor/golang.org/x/text/internal/match.go b/vendor/golang.org/x/text/internal/match.go new file mode 100644 index 0000000..1cc004a --- /dev/null +++ b/vendor/golang.org/x/text/internal/match.go @@ -0,0 +1,67 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package internal + +// This file contains matchers that implement CLDR inheritance. +// +// See https://unicode.org/reports/tr35/#Locale_Inheritance. +// +// Some of the inheritance described in this document is already handled by +// the cldr package. + +import ( + "golang.org/x/text/language" +) + +// TODO: consider if (some of the) matching algorithm needs to be public after +// getting some feel about what is generic and what is specific. + +// NewInheritanceMatcher returns a matcher that matches based on the inheritance +// chain. +// +// The matcher uses canonicalization and the parent relationship to find a +// match. The resulting match will always be either Und or a language with the +// same language and script as the requested language. It will not match +// languages for which there is understood to be mutual or one-directional +// intelligibility. +// +// A Match will indicate an Exact match if the language matches after +// canonicalization and High if the matched tag is a parent. +func NewInheritanceMatcher(t []language.Tag) *InheritanceMatcher { + tags := &InheritanceMatcher{make(map[language.Tag]int)} + for i, tag := range t { + ct, err := language.All.Canonicalize(tag) + if err != nil { + ct = tag + } + tags.index[ct] = i + } + return tags +} + +type InheritanceMatcher struct { + index map[language.Tag]int +} + +func (m InheritanceMatcher) Match(want ...language.Tag) (language.Tag, int, language.Confidence) { + for _, t := range want { + ct, err := language.All.Canonicalize(t) + if err != nil { + ct = t + } + conf := language.Exact + for { + if index, ok := m.index[ct]; ok { + return ct, index, conf + } + if ct == language.Und { + break + } + ct = ct.Parent() + conf = language.High + } + } + return language.Und, 0, language.No +} diff --git a/vendor/golang.org/x/text/internal/number/common.go b/vendor/golang.org/x/text/internal/number/common.go new file mode 100644 index 0000000..a6e9c8e --- /dev/null +++ b/vendor/golang.org/x/text/internal/number/common.go @@ -0,0 +1,55 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package number + +import ( + "unicode/utf8" + + "golang.org/x/text/internal/language/compact" +) + +// A system identifies a CLDR numbering system. +type system byte + +type systemData struct { + id system + digitSize byte // number of UTF-8 bytes per digit + zero [utf8.UTFMax]byte // UTF-8 sequence of zero digit. +} + +// A SymbolType identifies a symbol of a specific kind. +type SymbolType int + +const ( + SymDecimal SymbolType = iota + SymGroup + SymList + SymPercentSign + SymPlusSign + SymMinusSign + SymExponential + SymSuperscriptingExponent + SymPerMille + SymInfinity + SymNan + SymTimeSeparator + + NumSymbolTypes +) + +const hasNonLatnMask = 0x8000 + +// symOffset is an offset into altSymData if the bit indicated by hasNonLatnMask +// is not 0 (with this bit masked out), and an offset into symIndex otherwise. +// +// TODO: this type can be a byte again if we use an indirection into altsymData +// and introduce an alt -> offset slice (the length of this will be number of +// alternatives plus 1). This also allows getting rid of the compactTag field +// in altSymData. In total this will save about 1K. +type symOffset uint16 + +type altSymData struct { + compactTag compact.ID + symIndex symOffset + system system +} diff --git a/vendor/golang.org/x/text/internal/number/decimal.go b/vendor/golang.org/x/text/internal/number/decimal.go new file mode 100644 index 0000000..e128cf3 --- /dev/null +++ b/vendor/golang.org/x/text/internal/number/decimal.go @@ -0,0 +1,500 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate stringer -type RoundingMode + +package number + +import ( + "math" + "strconv" +) + +// RoundingMode determines how a number is rounded to the desired precision. +type RoundingMode byte + +const ( + ToNearestEven RoundingMode = iota // towards the nearest integer, or towards an even number if equidistant. + ToNearestZero // towards the nearest integer, or towards zero if equidistant. + ToNearestAway // towards the nearest integer, or away from zero if equidistant. + ToPositiveInf // towards infinity + ToNegativeInf // towards negative infinity + ToZero // towards zero + AwayFromZero // away from zero + numModes +) + +const maxIntDigits = 20 + +// A Decimal represents a floating point number in decimal format. +// Digits represents a number [0, 1.0), and the absolute value represented by +// Decimal is Digits * 10^Exp. Leading and trailing zeros may be omitted and Exp +// may point outside a valid position in Digits. +// +// Examples: +// +// Number Decimal +// 12345 Digits: [1, 2, 3, 4, 5], Exp: 5 +// 12.345 Digits: [1, 2, 3, 4, 5], Exp: 2 +// 12000 Digits: [1, 2], Exp: 5 +// 12000.00 Digits: [1, 2], Exp: 5 +// 0.00123 Digits: [1, 2, 3], Exp: -2 +// 0 Digits: [], Exp: 0 +type Decimal struct { + digits + + buf [maxIntDigits]byte +} + +type digits struct { + Digits []byte // mantissa digits, big-endian + Exp int32 // exponent + Neg bool + Inf bool // Takes precedence over Digits and Exp. + NaN bool // Takes precedence over Inf. +} + +// Digits represents a floating point number represented in digits of the +// base in which a number is to be displayed. It is similar to Decimal, but +// keeps track of trailing fraction zeros and the comma placement for +// engineering notation. Digits must have at least one digit. +// +// Examples: +// +// Number Decimal +// decimal +// 12345 Digits: [1, 2, 3, 4, 5], Exp: 5 End: 5 +// 12.345 Digits: [1, 2, 3, 4, 5], Exp: 2 End: 5 +// 12000 Digits: [1, 2], Exp: 5 End: 5 +// 12000.00 Digits: [1, 2], Exp: 5 End: 7 +// 0.00123 Digits: [1, 2, 3], Exp: -2 End: 3 +// 0 Digits: [], Exp: 0 End: 1 +// scientific (actual exp is Exp - Comma) +// 0e0 Digits: [0], Exp: 1, End: 1, Comma: 1 +// .0e0 Digits: [0], Exp: 0, End: 1, Comma: 0 +// 0.0e0 Digits: [0], Exp: 1, End: 2, Comma: 1 +// 1.23e4 Digits: [1, 2, 3], Exp: 5, End: 3, Comma: 1 +// .123e5 Digits: [1, 2, 3], Exp: 5, End: 3, Comma: 0 +// engineering +// 12.3e3 Digits: [1, 2, 3], Exp: 5, End: 3, Comma: 2 +type Digits struct { + digits + // End indicates the end position of the number. + End int32 // For decimals Exp <= End. For scientific len(Digits) <= End. + // Comma is used for the comma position for scientific (always 0 or 1) and + // engineering notation (always 0, 1, 2, or 3). + Comma uint8 + // IsScientific indicates whether this number is to be rendered as a + // scientific number. + IsScientific bool +} + +func (d *Digits) NumFracDigits() int { + if d.Exp >= d.End { + return 0 + } + return int(d.End - d.Exp) +} + +// normalize returns a new Decimal with leading and trailing zeros removed. +func (d *Decimal) normalize() (n Decimal) { + n = *d + b := n.Digits + // Strip leading zeros. Resulting number of digits is significant digits. + for len(b) > 0 && b[0] == 0 { + b = b[1:] + n.Exp-- + } + // Strip trailing zeros + for len(b) > 0 && b[len(b)-1] == 0 { + b = b[:len(b)-1] + } + if len(b) == 0 { + n.Exp = 0 + } + n.Digits = b + return n +} + +func (d *Decimal) clear() { + b := d.Digits + if b == nil { + b = d.buf[:0] + } + *d = Decimal{} + d.Digits = b[:0] +} + +func (x *Decimal) String() string { + if x.NaN { + return "NaN" + } + var buf []byte + if x.Neg { + buf = append(buf, '-') + } + if x.Inf { + buf = append(buf, "Inf"...) + return string(buf) + } + switch { + case len(x.Digits) == 0: + buf = append(buf, '0') + case x.Exp <= 0: + // 0.00ddd + buf = append(buf, "0."...) + buf = appendZeros(buf, -int(x.Exp)) + buf = appendDigits(buf, x.Digits) + + case /* 0 < */ int(x.Exp) < len(x.Digits): + // dd.ddd + buf = appendDigits(buf, x.Digits[:x.Exp]) + buf = append(buf, '.') + buf = appendDigits(buf, x.Digits[x.Exp:]) + + default: // len(x.Digits) <= x.Exp + // ddd00 + buf = appendDigits(buf, x.Digits) + buf = appendZeros(buf, int(x.Exp)-len(x.Digits)) + } + return string(buf) +} + +func appendDigits(buf []byte, digits []byte) []byte { + for _, c := range digits { + buf = append(buf, c+'0') + } + return buf +} + +// appendZeros appends n 0 digits to buf and returns buf. +func appendZeros(buf []byte, n int) []byte { + for ; n > 0; n-- { + buf = append(buf, '0') + } + return buf +} + +func (d *digits) round(mode RoundingMode, n int) { + if n >= len(d.Digits) { + return + } + // Make rounding decision: The result mantissa is truncated ("rounded down") + // by default. Decide if we need to increment, or "round up", the (unsigned) + // mantissa. + inc := false + switch mode { + case ToNegativeInf: + inc = d.Neg + case ToPositiveInf: + inc = !d.Neg + case ToZero: + // nothing to do + case AwayFromZero: + inc = true + case ToNearestEven: + inc = d.Digits[n] > 5 || d.Digits[n] == 5 && + (len(d.Digits) > n+1 || n == 0 || d.Digits[n-1]&1 != 0) + case ToNearestAway: + inc = d.Digits[n] >= 5 + case ToNearestZero: + inc = d.Digits[n] > 5 || d.Digits[n] == 5 && len(d.Digits) > n+1 + default: + panic("unreachable") + } + if inc { + d.roundUp(n) + } else { + d.roundDown(n) + } +} + +// roundFloat rounds a floating point number. +func (r RoundingMode) roundFloat(x float64) float64 { + // Make rounding decision: The result mantissa is truncated ("rounded down") + // by default. Decide if we need to increment, or "round up", the (unsigned) + // mantissa. + abs := x + if x < 0 { + abs = -x + } + i, f := math.Modf(abs) + if f == 0.0 { + return x + } + inc := false + switch r { + case ToNegativeInf: + inc = x < 0 + case ToPositiveInf: + inc = x >= 0 + case ToZero: + // nothing to do + case AwayFromZero: + inc = true + case ToNearestEven: + // TODO: check overflow + inc = f > 0.5 || f == 0.5 && int64(i)&1 != 0 + case ToNearestAway: + inc = f >= 0.5 + case ToNearestZero: + inc = f > 0.5 + default: + panic("unreachable") + } + if inc { + i += 1 + } + if abs != x { + i = -i + } + return i +} + +func (x *digits) roundUp(n int) { + if n < 0 || n >= len(x.Digits) { + return // nothing to do + } + // find first digit < 9 + for n > 0 && x.Digits[n-1] >= 9 { + n-- + } + + if n == 0 { + // all digits are 9s => round up to 1 and update exponent + x.Digits[0] = 1 // ok since len(x.Digits) > n + x.Digits = x.Digits[:1] + x.Exp++ + return + } + x.Digits[n-1]++ + x.Digits = x.Digits[:n] + // x already trimmed +} + +func (x *digits) roundDown(n int) { + if n < 0 || n >= len(x.Digits) { + return // nothing to do + } + x.Digits = x.Digits[:n] + trim(x) +} + +// trim cuts off any trailing zeros from x's mantissa; +// they are meaningless for the value of x. +func trim(x *digits) { + i := len(x.Digits) + for i > 0 && x.Digits[i-1] == 0 { + i-- + } + x.Digits = x.Digits[:i] + if i == 0 { + x.Exp = 0 + } +} + +// A Converter converts a number into decimals according to the given rounding +// criteria. +type Converter interface { + Convert(d *Decimal, r RoundingContext) +} + +const ( + signed = true + unsigned = false +) + +// Convert converts the given number to the decimal representation using the +// supplied RoundingContext. +func (d *Decimal) Convert(r RoundingContext, number interface{}) { + switch f := number.(type) { + case Converter: + d.clear() + f.Convert(d, r) + case float32: + d.ConvertFloat(r, float64(f), 32) + case float64: + d.ConvertFloat(r, f, 64) + case int: + d.ConvertInt(r, signed, uint64(f)) + case int8: + d.ConvertInt(r, signed, uint64(f)) + case int16: + d.ConvertInt(r, signed, uint64(f)) + case int32: + d.ConvertInt(r, signed, uint64(f)) + case int64: + d.ConvertInt(r, signed, uint64(f)) + case uint: + d.ConvertInt(r, unsigned, uint64(f)) + case uint8: + d.ConvertInt(r, unsigned, uint64(f)) + case uint16: + d.ConvertInt(r, unsigned, uint64(f)) + case uint32: + d.ConvertInt(r, unsigned, uint64(f)) + case uint64: + d.ConvertInt(r, unsigned, f) + + default: + d.NaN = true + // TODO: + // case string: if produced by strconv, allows for easy arbitrary pos. + // case reflect.Value: + // case big.Float + // case big.Int + // case big.Rat? + // catch underlyings using reflect or will this already be done by the + // message package? + } +} + +// ConvertInt converts an integer to decimals. +func (d *Decimal) ConvertInt(r RoundingContext, signed bool, x uint64) { + if r.Increment > 0 { + // TODO: if uint64 is too large, fall back to float64 + if signed { + d.ConvertFloat(r, float64(int64(x)), 64) + } else { + d.ConvertFloat(r, float64(x), 64) + } + return + } + d.clear() + if signed && int64(x) < 0 { + x = uint64(-int64(x)) + d.Neg = true + } + d.fillIntDigits(x) + d.Exp = int32(len(d.Digits)) +} + +// ConvertFloat converts a floating point number to decimals. +func (d *Decimal) ConvertFloat(r RoundingContext, x float64, size int) { + d.clear() + if math.IsNaN(x) { + d.NaN = true + return + } + // Simple case: decimal notation + if r.Increment > 0 { + scale := int(r.IncrementScale) + mult := 1.0 + if scale >= len(scales) { + mult = math.Pow(10, float64(scale)) + } else { + mult = scales[scale] + } + // We multiply x instead of dividing inc as it gives less rounding + // issues. + x *= mult + x /= float64(r.Increment) + x = r.Mode.roundFloat(x) + x *= float64(r.Increment) + x /= mult + } + + abs := x + if x < 0 { + d.Neg = true + abs = -x + } + if math.IsInf(abs, 1) { + d.Inf = true + return + } + + // By default we get the exact decimal representation. + verb := byte('g') + prec := -1 + // As the strconv API does not return the rounding accuracy, we can only + // round using ToNearestEven. + if r.Mode == ToNearestEven { + if n := r.RoundSignificantDigits(); n >= 0 { + prec = n + } else if n = r.RoundFractionDigits(); n >= 0 { + prec = n + verb = 'f' + } + } else { + // TODO: At this point strconv's rounding is imprecise to the point that + // it is not usable for this purpose. + // See https://github.com/golang/go/issues/21714 + // If rounding is requested, we ask for a large number of digits and + // round from there to simulate rounding only once. + // Ideally we would have strconv export an AppendDigits that would take + // a rounding mode and/or return an accuracy. Something like this would + // work: + // AppendDigits(dst []byte, x float64, base, size, prec int) (digits []byte, exp, accuracy int) + hasPrec := r.RoundSignificantDigits() >= 0 + hasScale := r.RoundFractionDigits() >= 0 + if hasPrec || hasScale { + // prec is the number of mantissa bits plus some extra for safety. + // We need at least the number of mantissa bits as decimals to + // accurately represent the floating point without rounding, as each + // bit requires one more decimal to represent: 0.5, 0.25, 0.125, ... + prec = 60 + } + } + + b := strconv.AppendFloat(d.Digits[:0], abs, verb, prec, size) + i := 0 + k := 0 + beforeDot := 1 + for i < len(b) { + if c := b[i]; '0' <= c && c <= '9' { + b[k] = c - '0' + k++ + d.Exp += int32(beforeDot) + } else if c == '.' { + beforeDot = 0 + d.Exp = int32(k) + } else { + break + } + i++ + } + d.Digits = b[:k] + if i != len(b) { + i += len("e") + pSign := i + exp := 0 + for i++; i < len(b); i++ { + exp *= 10 + exp += int(b[i] - '0') + } + if b[pSign] == '-' { + exp = -exp + } + d.Exp = int32(exp) + 1 + } +} + +func (d *Decimal) fillIntDigits(x uint64) { + if cap(d.Digits) < maxIntDigits { + d.Digits = d.buf[:] + } else { + d.Digits = d.buf[:maxIntDigits] + } + i := 0 + for ; x > 0; x /= 10 { + d.Digits[i] = byte(x % 10) + i++ + } + d.Digits = d.Digits[:i] + for p := 0; p < i; p++ { + i-- + d.Digits[p], d.Digits[i] = d.Digits[i], d.Digits[p] + } +} + +var scales [70]float64 + +func init() { + x := 1.0 + for i := range scales { + scales[i] = x + x *= 10 + } +} diff --git a/vendor/golang.org/x/text/internal/number/format.go b/vendor/golang.org/x/text/internal/number/format.go new file mode 100644 index 0000000..1aadcf4 --- /dev/null +++ b/vendor/golang.org/x/text/internal/number/format.go @@ -0,0 +1,533 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package number + +import ( + "strconv" + "unicode/utf8" + + "golang.org/x/text/language" +) + +// TODO: +// - grouping of fractions +// - allow user-defined superscript notation (such as 4) +// - same for non-breaking spaces, like   + +// A VisibleDigits computes digits, comma placement and trailing zeros as they +// will be shown to the user. +type VisibleDigits interface { + Digits(buf []byte, t language.Tag, scale int) Digits + // TODO: Do we also need to add the verb or pass a format.State? +} + +// Formatting proceeds along the following lines: +// 0) Compose rounding information from format and context. +// 1) Convert a number into a Decimal. +// 2) Sanitize Decimal by adding trailing zeros, removing leading digits, and +// (non-increment) rounding. The Decimal that results from this is suitable +// for determining the plural form. +// 3) Render the Decimal in the localized form. + +// Formatter contains all the information needed to render a number. +type Formatter struct { + Pattern + Info +} + +func (f *Formatter) init(t language.Tag, index []uint8) { + f.Info = InfoFromTag(t) + f.Pattern = formats[index[tagToID(t)]] +} + +// InitPattern initializes a Formatter for the given Pattern. +func (f *Formatter) InitPattern(t language.Tag, pat *Pattern) { + f.Info = InfoFromTag(t) + f.Pattern = *pat +} + +// InitDecimal initializes a Formatter using the default Pattern for the given +// language. +func (f *Formatter) InitDecimal(t language.Tag) { + f.init(t, tagToDecimal) +} + +// InitScientific initializes a Formatter using the default Pattern for the +// given language. +func (f *Formatter) InitScientific(t language.Tag) { + f.init(t, tagToScientific) + f.Pattern.MinFractionDigits = 0 + f.Pattern.MaxFractionDigits = -1 +} + +// InitEngineering initializes a Formatter using the default Pattern for the +// given language. +func (f *Formatter) InitEngineering(t language.Tag) { + f.init(t, tagToScientific) + f.Pattern.MinFractionDigits = 0 + f.Pattern.MaxFractionDigits = -1 + f.Pattern.MaxIntegerDigits = 3 + f.Pattern.MinIntegerDigits = 1 +} + +// InitPercent initializes a Formatter using the default Pattern for the given +// language. +func (f *Formatter) InitPercent(t language.Tag) { + f.init(t, tagToPercent) +} + +// InitPerMille initializes a Formatter using the default Pattern for the given +// language. +func (f *Formatter) InitPerMille(t language.Tag) { + f.init(t, tagToPercent) + f.Pattern.DigitShift = 3 +} + +func (f *Formatter) Append(dst []byte, x interface{}) []byte { + var d Decimal + r := f.RoundingContext + d.Convert(r, x) + return f.Render(dst, FormatDigits(&d, r)) +} + +func FormatDigits(d *Decimal, r RoundingContext) Digits { + if r.isScientific() { + return scientificVisibleDigits(r, d) + } + return decimalVisibleDigits(r, d) +} + +func (f *Formatter) Format(dst []byte, d *Decimal) []byte { + return f.Render(dst, FormatDigits(d, f.RoundingContext)) +} + +func (f *Formatter) Render(dst []byte, d Digits) []byte { + var result []byte + var postPrefix, preSuffix int + if d.IsScientific { + result, postPrefix, preSuffix = appendScientific(dst, f, &d) + } else { + result, postPrefix, preSuffix = appendDecimal(dst, f, &d) + } + if f.PadRune == 0 { + return result + } + width := int(f.FormatWidth) + if count := utf8.RuneCount(result); count < width { + insertPos := 0 + switch f.Flags & PadMask { + case PadAfterPrefix: + insertPos = postPrefix + case PadBeforeSuffix: + insertPos = preSuffix + case PadAfterSuffix: + insertPos = len(result) + } + num := width - count + pad := [utf8.UTFMax]byte{' '} + sz := 1 + if r := f.PadRune; r != 0 { + sz = utf8.EncodeRune(pad[:], r) + } + extra := sz * num + if n := len(result) + extra; n < cap(result) { + result = result[:n] + copy(result[insertPos+extra:], result[insertPos:]) + } else { + buf := make([]byte, n) + copy(buf, result[:insertPos]) + copy(buf[insertPos+extra:], result[insertPos:]) + result = buf + } + for ; num > 0; num-- { + insertPos += copy(result[insertPos:], pad[:sz]) + } + } + return result +} + +// decimalVisibleDigits converts d according to the RoundingContext. Note that +// the exponent may change as a result of this operation. +func decimalVisibleDigits(r RoundingContext, d *Decimal) Digits { + if d.NaN || d.Inf { + return Digits{digits: digits{Neg: d.Neg, NaN: d.NaN, Inf: d.Inf}} + } + n := Digits{digits: d.normalize().digits} + + exp := n.Exp + exp += int32(r.DigitShift) + + // Cap integer digits. Remove *most-significant* digits. + if r.MaxIntegerDigits > 0 { + if p := int(exp) - int(r.MaxIntegerDigits); p > 0 { + if p > len(n.Digits) { + p = len(n.Digits) + } + if n.Digits = n.Digits[p:]; len(n.Digits) == 0 { + exp = 0 + } else { + exp -= int32(p) + } + // Strip leading zeros. + for len(n.Digits) > 0 && n.Digits[0] == 0 { + n.Digits = n.Digits[1:] + exp-- + } + } + } + + // Rounding if not already done by Convert. + p := len(n.Digits) + if maxSig := int(r.MaxSignificantDigits); maxSig > 0 { + p = maxSig + } + if maxFrac := int(r.MaxFractionDigits); maxFrac >= 0 { + if cap := int(exp) + maxFrac; cap < p { + p = int(exp) + maxFrac + } + if p < 0 { + p = 0 + } + } + n.round(r.Mode, p) + + // set End (trailing zeros) + n.End = int32(len(n.Digits)) + if n.End == 0 { + exp = 0 + if r.MinFractionDigits > 0 { + n.End = int32(r.MinFractionDigits) + } + if p := int32(r.MinSignificantDigits) - 1; p > n.End { + n.End = p + } + } else { + if end := exp + int32(r.MinFractionDigits); end > n.End { + n.End = end + } + if n.End < int32(r.MinSignificantDigits) { + n.End = int32(r.MinSignificantDigits) + } + } + n.Exp = exp + return n +} + +// appendDecimal appends a formatted number to dst. It returns two possible +// insertion points for padding. +func appendDecimal(dst []byte, f *Formatter, n *Digits) (b []byte, postPre, preSuf int) { + if dst, ok := f.renderSpecial(dst, n); ok { + return dst, 0, len(dst) + } + digits := n.Digits + exp := n.Exp + + // Split in integer and fraction part. + var intDigits, fracDigits []byte + numInt := 0 + numFrac := int(n.End - n.Exp) + if exp > 0 { + numInt = int(exp) + if int(exp) >= len(digits) { // ddddd | ddddd00 + intDigits = digits + } else { // ddd.dd + intDigits = digits[:exp] + fracDigits = digits[exp:] + } + } else { + fracDigits = digits + } + + neg := n.Neg + affix, suffix := f.getAffixes(neg) + dst = appendAffix(dst, f, affix, neg) + savedLen := len(dst) + + minInt := int(f.MinIntegerDigits) + if minInt == 0 && f.MinSignificantDigits > 0 { + minInt = 1 + } + // add leading zeros + for i := minInt; i > numInt; i-- { + dst = f.AppendDigit(dst, 0) + if f.needsSep(i) { + dst = append(dst, f.Symbol(SymGroup)...) + } + } + i := 0 + for ; i < len(intDigits); i++ { + dst = f.AppendDigit(dst, intDigits[i]) + if f.needsSep(numInt - i) { + dst = append(dst, f.Symbol(SymGroup)...) + } + } + for ; i < numInt; i++ { + dst = f.AppendDigit(dst, 0) + if f.needsSep(numInt - i) { + dst = append(dst, f.Symbol(SymGroup)...) + } + } + + if numFrac > 0 || f.Flags&AlwaysDecimalSeparator != 0 { + dst = append(dst, f.Symbol(SymDecimal)...) + } + // Add trailing zeros + i = 0 + for n := -int(n.Exp); i < n; i++ { + dst = f.AppendDigit(dst, 0) + } + for _, d := range fracDigits { + i++ + dst = f.AppendDigit(dst, d) + } + for ; i < numFrac; i++ { + dst = f.AppendDigit(dst, 0) + } + return appendAffix(dst, f, suffix, neg), savedLen, len(dst) +} + +func scientificVisibleDigits(r RoundingContext, d *Decimal) Digits { + if d.NaN || d.Inf { + return Digits{digits: digits{Neg: d.Neg, NaN: d.NaN, Inf: d.Inf}} + } + n := Digits{digits: d.normalize().digits, IsScientific: true} + + // Normalize to have at least one digit. This simplifies engineering + // notation. + if len(n.Digits) == 0 { + n.Digits = append(n.Digits, 0) + n.Exp = 1 + } + + // Significant digits are transformed by the parser for scientific notation + // and do not need to be handled here. + maxInt, numInt := int(r.MaxIntegerDigits), int(r.MinIntegerDigits) + if numInt == 0 { + numInt = 1 + } + + // If a maximum number of integers is specified, the minimum must be 1 + // and the exponent is grouped by this number (e.g. for engineering) + if maxInt > numInt { + // Correct the exponent to reflect a single integer digit. + numInt = 1 + // engineering + // 0.01234 ([12345]e-1) -> 1.2345e-2 12.345e-3 + // 12345 ([12345]e+5) -> 1.2345e4 12.345e3 + d := int(n.Exp-1) % maxInt + if d < 0 { + d += maxInt + } + numInt += d + } + + p := len(n.Digits) + if maxSig := int(r.MaxSignificantDigits); maxSig > 0 { + p = maxSig + } + if maxFrac := int(r.MaxFractionDigits); maxFrac >= 0 && numInt+maxFrac < p { + p = numInt + maxFrac + } + n.round(r.Mode, p) + + n.Comma = uint8(numInt) + n.End = int32(len(n.Digits)) + if minSig := int32(r.MinFractionDigits) + int32(numInt); n.End < minSig { + n.End = minSig + } + return n +} + +// appendScientific appends a formatted number to dst. It returns two possible +// insertion points for padding. +func appendScientific(dst []byte, f *Formatter, n *Digits) (b []byte, postPre, preSuf int) { + if dst, ok := f.renderSpecial(dst, n); ok { + return dst, 0, 0 + } + digits := n.Digits + numInt := int(n.Comma) + numFrac := int(n.End) - int(n.Comma) + + var intDigits, fracDigits []byte + if numInt <= len(digits) { + intDigits = digits[:numInt] + fracDigits = digits[numInt:] + } else { + intDigits = digits + } + neg := n.Neg + affix, suffix := f.getAffixes(neg) + dst = appendAffix(dst, f, affix, neg) + savedLen := len(dst) + + i := 0 + for ; i < len(intDigits); i++ { + dst = f.AppendDigit(dst, intDigits[i]) + if f.needsSep(numInt - i) { + dst = append(dst, f.Symbol(SymGroup)...) + } + } + for ; i < numInt; i++ { + dst = f.AppendDigit(dst, 0) + if f.needsSep(numInt - i) { + dst = append(dst, f.Symbol(SymGroup)...) + } + } + + if numFrac > 0 || f.Flags&AlwaysDecimalSeparator != 0 { + dst = append(dst, f.Symbol(SymDecimal)...) + } + i = 0 + for ; i < len(fracDigits); i++ { + dst = f.AppendDigit(dst, fracDigits[i]) + } + for ; i < numFrac; i++ { + dst = f.AppendDigit(dst, 0) + } + + // exp + buf := [12]byte{} + // TODO: use exponential if superscripting is not available (no Latin + // numbers or no tags) and use exponential in all other cases. + exp := n.Exp - int32(n.Comma) + exponential := f.Symbol(SymExponential) + if exponential == "E" { + dst = append(dst, f.Symbol(SymSuperscriptingExponent)...) + dst = f.AppendDigit(dst, 1) + dst = f.AppendDigit(dst, 0) + switch { + case exp < 0: + dst = append(dst, superMinus...) + exp = -exp + case f.Flags&AlwaysExpSign != 0: + dst = append(dst, superPlus...) + } + b = strconv.AppendUint(buf[:0], uint64(exp), 10) + for i := len(b); i < int(f.MinExponentDigits); i++ { + dst = append(dst, superDigits[0]...) + } + for _, c := range b { + dst = append(dst, superDigits[c-'0']...) + } + } else { + dst = append(dst, exponential...) + switch { + case exp < 0: + dst = append(dst, f.Symbol(SymMinusSign)...) + exp = -exp + case f.Flags&AlwaysExpSign != 0: + dst = append(dst, f.Symbol(SymPlusSign)...) + } + b = strconv.AppendUint(buf[:0], uint64(exp), 10) + for i := len(b); i < int(f.MinExponentDigits); i++ { + dst = f.AppendDigit(dst, 0) + } + for _, c := range b { + dst = f.AppendDigit(dst, c-'0') + } + } + return appendAffix(dst, f, suffix, neg), savedLen, len(dst) +} + +const ( + superMinus = "\u207B" // SUPERSCRIPT HYPHEN-MINUS + superPlus = "\u207A" // SUPERSCRIPT PLUS SIGN +) + +var ( + // Note: the digits are not sequential!!! + superDigits = []string{ + "\u2070", // SUPERSCRIPT DIGIT ZERO + "\u00B9", // SUPERSCRIPT DIGIT ONE + "\u00B2", // SUPERSCRIPT DIGIT TWO + "\u00B3", // SUPERSCRIPT DIGIT THREE + "\u2074", // SUPERSCRIPT DIGIT FOUR + "\u2075", // SUPERSCRIPT DIGIT FIVE + "\u2076", // SUPERSCRIPT DIGIT SIX + "\u2077", // SUPERSCRIPT DIGIT SEVEN + "\u2078", // SUPERSCRIPT DIGIT EIGHT + "\u2079", // SUPERSCRIPT DIGIT NINE + } +) + +func (f *Formatter) getAffixes(neg bool) (affix, suffix string) { + str := f.Affix + if str != "" { + if f.NegOffset > 0 { + if neg { + str = str[f.NegOffset:] + } else { + str = str[:f.NegOffset] + } + } + sufStart := 1 + str[0] + affix = str[1:sufStart] + suffix = str[sufStart+1:] + } + // TODO: introduce a NeedNeg sign to indicate if the left pattern already + // has a sign marked? + if f.NegOffset == 0 && (neg || f.Flags&AlwaysSign != 0) { + affix = "-" + affix + } + return affix, suffix +} + +func (f *Formatter) renderSpecial(dst []byte, d *Digits) (b []byte, ok bool) { + if d.NaN { + return fmtNaN(dst, f), true + } + if d.Inf { + return fmtInfinite(dst, f, d), true + } + return dst, false +} + +func fmtNaN(dst []byte, f *Formatter) []byte { + return append(dst, f.Symbol(SymNan)...) +} + +func fmtInfinite(dst []byte, f *Formatter, d *Digits) []byte { + affix, suffix := f.getAffixes(d.Neg) + dst = appendAffix(dst, f, affix, d.Neg) + dst = append(dst, f.Symbol(SymInfinity)...) + dst = appendAffix(dst, f, suffix, d.Neg) + return dst +} + +func appendAffix(dst []byte, f *Formatter, affix string, neg bool) []byte { + quoting := false + escaping := false + for _, r := range affix { + switch { + case escaping: + // escaping occurs both inside and outside of quotes + dst = append(dst, string(r)...) + escaping = false + case r == '\\': + escaping = true + case r == '\'': + quoting = !quoting + case quoting: + dst = append(dst, string(r)...) + case r == '%': + if f.DigitShift == 3 { + dst = append(dst, f.Symbol(SymPerMille)...) + } else { + dst = append(dst, f.Symbol(SymPercentSign)...) + } + case r == '-' || r == '+': + if neg { + dst = append(dst, f.Symbol(SymMinusSign)...) + } else if f.Flags&ElideSign == 0 { + dst = append(dst, f.Symbol(SymPlusSign)...) + } else { + dst = append(dst, ' ') + } + default: + dst = append(dst, string(r)...) + } + } + return dst +} diff --git a/vendor/golang.org/x/text/internal/number/number.go b/vendor/golang.org/x/text/internal/number/number.go new file mode 100644 index 0000000..e1d933c --- /dev/null +++ b/vendor/golang.org/x/text/internal/number/number.go @@ -0,0 +1,152 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_common.go + +// Package number contains tools and data for formatting numbers. +package number + +import ( + "unicode/utf8" + + "golang.org/x/text/internal/language/compact" + "golang.org/x/text/language" +) + +// Info holds number formatting configuration data. +type Info struct { + system systemData // numbering system information + symIndex symOffset // index to symbols +} + +// InfoFromLangID returns a Info for the given compact language identifier and +// numbering system identifier. If system is the empty string, the default +// numbering system will be taken for that language. +func InfoFromLangID(compactIndex compact.ID, numberSystem string) Info { + p := langToDefaults[compactIndex] + // Lookup the entry for the language. + pSymIndex := symOffset(0) // Default: Latin, default symbols + system, ok := systemMap[numberSystem] + if !ok { + // Take the value for the default numbering system. This is by far the + // most common case as an alternative numbering system is hardly used. + if p&hasNonLatnMask == 0 { // Latn digits. + pSymIndex = p + } else { // Non-Latn or multiple numbering systems. + // Take the first entry from the alternatives list. + data := langToAlt[p&^hasNonLatnMask] + pSymIndex = data.symIndex + system = data.system + } + } else { + langIndex := compactIndex + ns := system + outerLoop: + for ; ; p = langToDefaults[langIndex] { + if p&hasNonLatnMask == 0 { + if ns == 0 { + // The index directly points to the symbol data. + pSymIndex = p + break + } + // Move to the parent and retry. + langIndex = langIndex.Parent() + } else { + // The index points to a list of symbol data indexes. + for _, e := range langToAlt[p&^hasNonLatnMask:] { + if e.compactTag != langIndex { + if langIndex == 0 { + // The CLDR root defines full symbol information for + // all numbering systems (even though mostly by + // means of aliases). Fall back to the default entry + // for Latn if there is no data for the numbering + // system of this language. + if ns == 0 { + break + } + // Fall back to Latin and start from the original + // language. See + // https://unicode.org/reports/tr35/#Locale_Inheritance. + ns = numLatn + langIndex = compactIndex + continue outerLoop + } + // Fall back to parent. + langIndex = langIndex.Parent() + } else if e.system == ns { + pSymIndex = e.symIndex + break outerLoop + } + } + } + } + } + if int(system) >= len(numSysData) { // algorithmic + // Will generate ASCII digits in case the user inadvertently calls + // WriteDigit or Digit on it. + d := numSysData[0] + d.id = system + return Info{ + system: d, + symIndex: pSymIndex, + } + } + return Info{ + system: numSysData[system], + symIndex: pSymIndex, + } +} + +// InfoFromTag returns a Info for the given language tag. +func InfoFromTag(t language.Tag) Info { + return InfoFromLangID(tagToID(t), t.TypeForKey("nu")) +} + +// IsDecimal reports if the numbering system can convert decimal to native +// symbols one-to-one. +func (n Info) IsDecimal() bool { + return int(n.system.id) < len(numSysData) +} + +// WriteDigit writes the UTF-8 sequence for n corresponding to the given ASCII +// digit to dst and reports the number of bytes written. dst must be large +// enough to hold the rune (can be up to utf8.UTFMax bytes). +func (n Info) WriteDigit(dst []byte, asciiDigit rune) int { + copy(dst, n.system.zero[:n.system.digitSize]) + dst[n.system.digitSize-1] += byte(asciiDigit - '0') + return int(n.system.digitSize) +} + +// AppendDigit appends the UTF-8 sequence for n corresponding to the given digit +// to dst and reports the number of bytes written. dst must be large enough to +// hold the rune (can be up to utf8.UTFMax bytes). +func (n Info) AppendDigit(dst []byte, digit byte) []byte { + dst = append(dst, n.system.zero[:n.system.digitSize]...) + dst[len(dst)-1] += digit + return dst +} + +// Digit returns the digit for the numbering system for the corresponding ASCII +// value. For example, ni.Digit('3') could return '三'. Note that the argument +// is the rune constant '3', which equals 51, not the integer constant 3. +func (n Info) Digit(asciiDigit rune) rune { + var x [utf8.UTFMax]byte + n.WriteDigit(x[:], asciiDigit) + r, _ := utf8.DecodeRune(x[:]) + return r +} + +// Symbol returns the string for the given symbol type. +func (n Info) Symbol(t SymbolType) string { + return symData.Elem(int(symIndex[n.symIndex][t])) +} + +func formatForLang(t language.Tag, index []byte) *Pattern { + return &formats[index[tagToID(t)]] +} + +func tagToID(t language.Tag) compact.ID { + id, _ := compact.RegionalID(compact.Tag(t)) + return id +} diff --git a/vendor/golang.org/x/text/internal/number/pattern.go b/vendor/golang.org/x/text/internal/number/pattern.go new file mode 100644 index 0000000..06e5955 --- /dev/null +++ b/vendor/golang.org/x/text/internal/number/pattern.go @@ -0,0 +1,485 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package number + +import ( + "errors" + "unicode/utf8" +) + +// This file contains a parser for the CLDR number patterns as described in +// https://unicode.org/reports/tr35/tr35-numbers.html#Number_Format_Patterns. +// +// The following BNF is derived from this standard. +// +// pattern := subpattern (';' subpattern)? +// subpattern := affix? number exponent? affix? +// number := decimal | sigDigits +// decimal := '#'* '0'* ('.' fraction)? | '#' | '0' +// fraction := '0'* '#'* +// sigDigits := '#'* '@' '@'* '#'* +// exponent := 'E' '+'? '0'* '0' +// padSpec := '*' \L +// +// Notes: +// - An affix pattern may contain any runes, but runes with special meaning +// should be escaped. +// - Sequences of digits, '#', and '@' in decimal and sigDigits may have +// interstitial commas. + +// TODO: replace special characters in affixes (-, +, ¤) with control codes. + +// Pattern holds information for formatting numbers. It is designed to hold +// information from CLDR number patterns. +// +// This pattern is precompiled for all patterns for all languages. Even though +// the number of patterns is not very large, we want to keep this small. +// +// This type is only intended for internal use. +type Pattern struct { + RoundingContext + + Affix string // includes prefix and suffix. First byte is prefix length. + Offset uint16 // Offset into Affix for prefix and suffix + NegOffset uint16 // Offset into Affix for negative prefix and suffix or 0. + PadRune rune + FormatWidth uint16 + + GroupingSize [2]uint8 + Flags PatternFlag +} + +// A RoundingContext indicates how a number should be converted to digits. +// It contains all information needed to determine the "visible digits" as +// required by the pluralization rules. +type RoundingContext struct { + // TODO: unify these two fields so that there is a more unambiguous meaning + // of how precision is handled. + MaxSignificantDigits int16 // -1 is unlimited + MaxFractionDigits int16 // -1 is unlimited + + Increment uint32 + IncrementScale uint8 // May differ from printed scale. + + Mode RoundingMode + + DigitShift uint8 // Number of decimals to shift. Used for % and ‰. + + // Number of digits. + MinIntegerDigits uint8 + + MaxIntegerDigits uint8 + MinFractionDigits uint8 + MinSignificantDigits uint8 + + MinExponentDigits uint8 +} + +// RoundSignificantDigits returns the number of significant digits an +// implementation of Convert may round to or n < 0 if there is no maximum or +// a maximum is not recommended. +func (r *RoundingContext) RoundSignificantDigits() (n int) { + if r.MaxFractionDigits == 0 && r.MaxSignificantDigits > 0 { + return int(r.MaxSignificantDigits) + } else if r.isScientific() && r.MaxIntegerDigits == 1 { + if r.MaxSignificantDigits == 0 || + int(r.MaxFractionDigits+1) == int(r.MaxSignificantDigits) { + // Note: don't add DigitShift: it is only used for decimals. + return int(r.MaxFractionDigits) + 1 + } + } + return -1 +} + +// RoundFractionDigits returns the number of fraction digits an implementation +// of Convert may round to or n < 0 if there is no maximum or a maximum is not +// recommended. +func (r *RoundingContext) RoundFractionDigits() (n int) { + if r.MinExponentDigits == 0 && + r.MaxSignificantDigits == 0 && + r.MaxFractionDigits >= 0 { + return int(r.MaxFractionDigits) + int(r.DigitShift) + } + return -1 +} + +// SetScale fixes the RoundingContext to a fixed number of fraction digits. +func (r *RoundingContext) SetScale(scale int) { + r.MinFractionDigits = uint8(scale) + r.MaxFractionDigits = int16(scale) +} + +func (r *RoundingContext) SetPrecision(prec int) { + r.MaxSignificantDigits = int16(prec) +} + +func (r *RoundingContext) isScientific() bool { + return r.MinExponentDigits > 0 +} + +func (f *Pattern) needsSep(pos int) bool { + p := pos - 1 + size := int(f.GroupingSize[0]) + if size == 0 || p == 0 { + return false + } + if p == size { + return true + } + if p -= size; p < 0 { + return false + } + // TODO: make second groupingsize the same as first if 0 so that we can + // avoid this check. + if x := int(f.GroupingSize[1]); x != 0 { + size = x + } + return p%size == 0 +} + +// A PatternFlag is a bit mask for the flag field of a Pattern. +type PatternFlag uint8 + +const ( + AlwaysSign PatternFlag = 1 << iota + ElideSign // Use space instead of plus sign. AlwaysSign must be true. + AlwaysExpSign + AlwaysDecimalSeparator + ParenthesisForNegative // Common pattern. Saves space. + + PadAfterNumber + PadAfterAffix + + PadBeforePrefix = 0 // Default + PadAfterPrefix = PadAfterAffix + PadBeforeSuffix = PadAfterNumber + PadAfterSuffix = PadAfterNumber | PadAfterAffix + PadMask = PadAfterNumber | PadAfterAffix +) + +type parser struct { + *Pattern + + leadingSharps int + + pos int + err error + doNotTerminate bool + groupingCount uint + hasGroup bool + buf []byte +} + +func (p *parser) setError(err error) { + if p.err == nil { + p.err = err + } +} + +func (p *parser) updateGrouping() { + if p.hasGroup && + 0 < p.groupingCount && p.groupingCount < 255 { + p.GroupingSize[1] = p.GroupingSize[0] + p.GroupingSize[0] = uint8(p.groupingCount) + } + p.groupingCount = 0 + p.hasGroup = true +} + +var ( + // TODO: more sensible and localizeable error messages. + errMultiplePadSpecifiers = errors.New("format: pattern has multiple pad specifiers") + errInvalidPadSpecifier = errors.New("format: invalid pad specifier") + errInvalidQuote = errors.New("format: invalid quote") + errAffixTooLarge = errors.New("format: prefix or suffix exceeds maximum UTF-8 length of 256 bytes") + errDuplicatePercentSign = errors.New("format: duplicate percent sign") + errDuplicatePermilleSign = errors.New("format: duplicate permille sign") + errUnexpectedEnd = errors.New("format: unexpected end of pattern") +) + +// ParsePattern extracts formatting information from a CLDR number pattern. +// +// See https://unicode.org/reports/tr35/tr35-numbers.html#Number_Format_Patterns. +func ParsePattern(s string) (f *Pattern, err error) { + p := parser{Pattern: &Pattern{}} + + s = p.parseSubPattern(s) + + if s != "" { + // Parse negative sub pattern. + if s[0] != ';' { + p.setError(errors.New("format: error parsing first sub pattern")) + return nil, p.err + } + neg := parser{Pattern: &Pattern{}} // just for extracting the affixes. + s = neg.parseSubPattern(s[len(";"):]) + p.NegOffset = uint16(len(p.buf)) + p.buf = append(p.buf, neg.buf...) + } + if s != "" { + p.setError(errors.New("format: spurious characters at end of pattern")) + } + if p.err != nil { + return nil, p.err + } + if affix := string(p.buf); affix == "\x00\x00" || affix == "\x00\x00\x00\x00" { + // No prefix or suffixes. + p.NegOffset = 0 + } else { + p.Affix = affix + } + if p.Increment == 0 { + p.IncrementScale = 0 + } + return p.Pattern, nil +} + +func (p *parser) parseSubPattern(s string) string { + s = p.parsePad(s, PadBeforePrefix) + s = p.parseAffix(s) + s = p.parsePad(s, PadAfterPrefix) + + s = p.parse(p.number, s) + p.updateGrouping() + + s = p.parsePad(s, PadBeforeSuffix) + s = p.parseAffix(s) + s = p.parsePad(s, PadAfterSuffix) + return s +} + +func (p *parser) parsePad(s string, f PatternFlag) (tail string) { + if len(s) >= 2 && s[0] == '*' { + r, sz := utf8.DecodeRuneInString(s[1:]) + if p.PadRune != 0 { + p.err = errMultiplePadSpecifiers + } else { + p.Flags |= f + p.PadRune = r + } + return s[1+sz:] + } + return s +} + +func (p *parser) parseAffix(s string) string { + x := len(p.buf) + p.buf = append(p.buf, 0) // placeholder for affix length + + s = p.parse(p.affix, s) + + n := len(p.buf) - x - 1 + if n > 0xFF { + p.setError(errAffixTooLarge) + } + p.buf[x] = uint8(n) + return s +} + +// state implements a state transition. It returns the new state. A state +// function may set an error on the parser or may simply return on an incorrect +// token and let the next phase fail. +type state func(r rune) state + +// parse repeatedly applies a state function on the given string until a +// termination condition is reached. +func (p *parser) parse(fn state, s string) (tail string) { + for i, r := range s { + p.doNotTerminate = false + if fn = fn(r); fn == nil || p.err != nil { + return s[i:] + } + p.FormatWidth++ + } + if p.doNotTerminate { + p.setError(errUnexpectedEnd) + } + return "" +} + +func (p *parser) affix(r rune) state { + switch r { + case '0', '1', '2', '3', '4', '5', '6', '7', '8', '9', + '#', '@', '.', '*', ',', ';': + return nil + case '\'': + p.FormatWidth-- + return p.escapeFirst + case '%': + if p.DigitShift != 0 { + p.setError(errDuplicatePercentSign) + } + p.DigitShift = 2 + case '\u2030': // ‰ Per mille + if p.DigitShift != 0 { + p.setError(errDuplicatePermilleSign) + } + p.DigitShift = 3 + // TODO: handle currency somehow: ¤, ¤¤, ¤¤¤, ¤¤¤¤ + } + p.buf = append(p.buf, string(r)...) + return p.affix +} + +func (p *parser) escapeFirst(r rune) state { + switch r { + case '\'': + p.buf = append(p.buf, "\\'"...) + return p.affix + default: + p.buf = append(p.buf, '\'') + p.buf = append(p.buf, string(r)...) + } + return p.escape +} + +func (p *parser) escape(r rune) state { + switch r { + case '\'': + p.FormatWidth-- + p.buf = append(p.buf, '\'') + return p.affix + default: + p.buf = append(p.buf, string(r)...) + } + return p.escape +} + +// number parses a number. The BNF says the integer part should always have +// a '0', but that does not appear to be the case according to the rest of the +// documentation. We will allow having only '#' numbers. +func (p *parser) number(r rune) state { + switch r { + case '#': + p.groupingCount++ + p.leadingSharps++ + case '@': + p.groupingCount++ + p.leadingSharps = 0 + p.MaxFractionDigits = -1 + return p.sigDigits(r) + case ',': + if p.leadingSharps == 0 { // no leading commas + return nil + } + p.updateGrouping() + case 'E': + p.MaxIntegerDigits = uint8(p.leadingSharps) + return p.exponent + case '.': // allow ".##" etc. + p.updateGrouping() + return p.fraction + case '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + return p.integer(r) + default: + return nil + } + return p.number +} + +func (p *parser) integer(r rune) state { + if !('0' <= r && r <= '9') { + var next state + switch r { + case 'E': + if p.leadingSharps > 0 { + p.MaxIntegerDigits = uint8(p.leadingSharps) + p.MinIntegerDigits + } + next = p.exponent + case '.': + next = p.fraction + case ',': + next = p.integer + } + p.updateGrouping() + return next + } + p.Increment = p.Increment*10 + uint32(r-'0') + p.groupingCount++ + p.MinIntegerDigits++ + return p.integer +} + +func (p *parser) sigDigits(r rune) state { + switch r { + case '@': + p.groupingCount++ + p.MaxSignificantDigits++ + p.MinSignificantDigits++ + case '#': + return p.sigDigitsFinal(r) + case 'E': + p.updateGrouping() + return p.normalizeSigDigitsWithExponent() + default: + p.updateGrouping() + return nil + } + return p.sigDigits +} + +func (p *parser) sigDigitsFinal(r rune) state { + switch r { + case '#': + p.groupingCount++ + p.MaxSignificantDigits++ + case 'E': + p.updateGrouping() + return p.normalizeSigDigitsWithExponent() + default: + p.updateGrouping() + return nil + } + return p.sigDigitsFinal +} + +func (p *parser) normalizeSigDigitsWithExponent() state { + p.MinIntegerDigits, p.MaxIntegerDigits = 1, 1 + p.MinFractionDigits = p.MinSignificantDigits - 1 + p.MaxFractionDigits = p.MaxSignificantDigits - 1 + p.MinSignificantDigits, p.MaxSignificantDigits = 0, 0 + return p.exponent +} + +func (p *parser) fraction(r rune) state { + switch r { + case '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + p.Increment = p.Increment*10 + uint32(r-'0') + p.IncrementScale++ + p.MinFractionDigits++ + p.MaxFractionDigits++ + case '#': + p.MaxFractionDigits++ + case 'E': + if p.leadingSharps > 0 { + p.MaxIntegerDigits = uint8(p.leadingSharps) + p.MinIntegerDigits + } + return p.exponent + default: + return nil + } + return p.fraction +} + +func (p *parser) exponent(r rune) state { + switch r { + case '+': + // Set mode and check it wasn't already set. + if p.Flags&AlwaysExpSign != 0 || p.MinExponentDigits > 0 { + break + } + p.Flags |= AlwaysExpSign + p.doNotTerminate = true + return p.exponent + case '0': + p.MinExponentDigits++ + return p.exponent + } + // termination condition + if p.MinExponentDigits == 0 { + p.setError(errors.New("format: need at least one digit")) + } + return nil +} diff --git a/vendor/golang.org/x/text/internal/number/roundingmode_string.go b/vendor/golang.org/x/text/internal/number/roundingmode_string.go new file mode 100644 index 0000000..bcc2247 --- /dev/null +++ b/vendor/golang.org/x/text/internal/number/roundingmode_string.go @@ -0,0 +1,30 @@ +// Code generated by "stringer -type RoundingMode"; DO NOT EDIT. + +package number + +import "strconv" + +func _() { + // An "invalid array index" compiler error signifies that the constant values have changed. + // Re-run the stringer command to generate them again. + var x [1]struct{} + _ = x[ToNearestEven-0] + _ = x[ToNearestZero-1] + _ = x[ToNearestAway-2] + _ = x[ToPositiveInf-3] + _ = x[ToNegativeInf-4] + _ = x[ToZero-5] + _ = x[AwayFromZero-6] + _ = x[numModes-7] +} + +const _RoundingMode_name = "ToNearestEvenToNearestZeroToNearestAwayToPositiveInfToNegativeInfToZeroAwayFromZeronumModes" + +var _RoundingMode_index = [...]uint8{0, 13, 26, 39, 52, 65, 71, 83, 91} + +func (i RoundingMode) String() string { + if i >= RoundingMode(len(_RoundingMode_index)-1) { + return "RoundingMode(" + strconv.FormatInt(int64(i), 10) + ")" + } + return _RoundingMode_name[_RoundingMode_index[i]:_RoundingMode_index[i+1]] +} diff --git a/vendor/golang.org/x/text/internal/number/tables.go b/vendor/golang.org/x/text/internal/number/tables.go new file mode 100644 index 0000000..8efce81 --- /dev/null +++ b/vendor/golang.org/x/text/internal/number/tables.go @@ -0,0 +1,1219 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package number + +import "golang.org/x/text/internal/stringset" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +var numSysData = []systemData{ // 59 elements + 0: {id: 0x0, digitSize: 0x1, zero: [4]uint8{0x30, 0x0, 0x0, 0x0}}, + 1: {id: 0x1, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9e, 0xa5, 0x90}}, + 2: {id: 0x2, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x9c, 0xb0}}, + 3: {id: 0x3, digitSize: 0x2, zero: [4]uint8{0xd9, 0xa0, 0x0, 0x0}}, + 4: {id: 0x4, digitSize: 0x2, zero: [4]uint8{0xdb, 0xb0, 0x0, 0x0}}, + 5: {id: 0x5, digitSize: 0x3, zero: [4]uint8{0xe1, 0xad, 0x90, 0x0}}, + 6: {id: 0x6, digitSize: 0x3, zero: [4]uint8{0xe0, 0xa7, 0xa6, 0x0}}, + 7: {id: 0x7, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0xb1, 0x90}}, + 8: {id: 0x8, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x81, 0xa6}}, + 9: {id: 0x9, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x84, 0xb6}}, + 10: {id: 0xa, digitSize: 0x3, zero: [4]uint8{0xea, 0xa9, 0x90, 0x0}}, + 11: {id: 0xb, digitSize: 0x3, zero: [4]uint8{0xe0, 0xa5, 0xa6, 0x0}}, + 12: {id: 0xc, digitSize: 0x3, zero: [4]uint8{0xef, 0xbc, 0x90, 0x0}}, + 13: {id: 0xd, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0xb5, 0x90}}, + 14: {id: 0xe, digitSize: 0x3, zero: [4]uint8{0xe0, 0xab, 0xa6, 0x0}}, + 15: {id: 0xf, digitSize: 0x3, zero: [4]uint8{0xe0, 0xa9, 0xa6, 0x0}}, + 16: {id: 0x10, digitSize: 0x4, zero: [4]uint8{0xf0, 0x96, 0xad, 0x90}}, + 17: {id: 0x11, digitSize: 0x3, zero: [4]uint8{0xea, 0xa7, 0x90, 0x0}}, + 18: {id: 0x12, digitSize: 0x3, zero: [4]uint8{0xea, 0xa4, 0x80, 0x0}}, + 19: {id: 0x13, digitSize: 0x3, zero: [4]uint8{0xe1, 0x9f, 0xa0, 0x0}}, + 20: {id: 0x14, digitSize: 0x3, zero: [4]uint8{0xe0, 0xb3, 0xa6, 0x0}}, + 21: {id: 0x15, digitSize: 0x3, zero: [4]uint8{0xe1, 0xaa, 0x80, 0x0}}, + 22: {id: 0x16, digitSize: 0x3, zero: [4]uint8{0xe1, 0xaa, 0x90, 0x0}}, + 23: {id: 0x17, digitSize: 0x3, zero: [4]uint8{0xe0, 0xbb, 0x90, 0x0}}, + 24: {id: 0x18, digitSize: 0x3, zero: [4]uint8{0xe1, 0xb1, 0x80, 0x0}}, + 25: {id: 0x19, digitSize: 0x3, zero: [4]uint8{0xe1, 0xa5, 0x86, 0x0}}, + 26: {id: 0x1a, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9d, 0x9f, 0x8e}}, + 27: {id: 0x1b, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9d, 0x9f, 0x98}}, + 28: {id: 0x1c, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9d, 0x9f, 0xb6}}, + 29: {id: 0x1d, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9d, 0x9f, 0xac}}, + 30: {id: 0x1e, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9d, 0x9f, 0xa2}}, + 31: {id: 0x1f, digitSize: 0x3, zero: [4]uint8{0xe0, 0xb5, 0xa6, 0x0}}, + 32: {id: 0x20, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x99, 0x90}}, + 33: {id: 0x21, digitSize: 0x3, zero: [4]uint8{0xe1, 0xa0, 0x90, 0x0}}, + 34: {id: 0x22, digitSize: 0x4, zero: [4]uint8{0xf0, 0x96, 0xa9, 0xa0}}, + 35: {id: 0x23, digitSize: 0x3, zero: [4]uint8{0xea, 0xaf, 0xb0, 0x0}}, + 36: {id: 0x24, digitSize: 0x3, zero: [4]uint8{0xe1, 0x81, 0x80, 0x0}}, + 37: {id: 0x25, digitSize: 0x3, zero: [4]uint8{0xe1, 0x82, 0x90, 0x0}}, + 38: {id: 0x26, digitSize: 0x3, zero: [4]uint8{0xea, 0xa7, 0xb0, 0x0}}, + 39: {id: 0x27, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x91, 0x90}}, + 40: {id: 0x28, digitSize: 0x2, zero: [4]uint8{0xdf, 0x80, 0x0, 0x0}}, + 41: {id: 0x29, digitSize: 0x3, zero: [4]uint8{0xe1, 0xb1, 0x90, 0x0}}, + 42: {id: 0x2a, digitSize: 0x3, zero: [4]uint8{0xe0, 0xad, 0xa6, 0x0}}, + 43: {id: 0x2b, digitSize: 0x4, zero: [4]uint8{0xf0, 0x90, 0x92, 0xa0}}, + 44: {id: 0x2c, digitSize: 0x3, zero: [4]uint8{0xea, 0xa3, 0x90, 0x0}}, + 45: {id: 0x2d, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x87, 0x90}}, + 46: {id: 0x2e, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x8b, 0xb0}}, + 47: {id: 0x2f, digitSize: 0x3, zero: [4]uint8{0xe0, 0xb7, 0xa6, 0x0}}, + 48: {id: 0x30, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x83, 0xb0}}, + 49: {id: 0x31, digitSize: 0x3, zero: [4]uint8{0xe1, 0xae, 0xb0, 0x0}}, + 50: {id: 0x32, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x9b, 0x80}}, + 51: {id: 0x33, digitSize: 0x3, zero: [4]uint8{0xe1, 0xa7, 0x90, 0x0}}, + 52: {id: 0x34, digitSize: 0x3, zero: [4]uint8{0xe0, 0xaf, 0xa6, 0x0}}, + 53: {id: 0x35, digitSize: 0x3, zero: [4]uint8{0xe0, 0xb1, 0xa6, 0x0}}, + 54: {id: 0x36, digitSize: 0x3, zero: [4]uint8{0xe0, 0xb9, 0x90, 0x0}}, + 55: {id: 0x37, digitSize: 0x3, zero: [4]uint8{0xe0, 0xbc, 0xa0, 0x0}}, + 56: {id: 0x38, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x93, 0x90}}, + 57: {id: 0x39, digitSize: 0x3, zero: [4]uint8{0xea, 0x98, 0xa0, 0x0}}, + 58: {id: 0x3a, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0xa3, 0xa0}}, +} // Size: 378 bytes + +const ( + numAdlm = 0x1 + numAhom = 0x2 + numArab = 0x3 + numArabext = 0x4 + numArmn = 0x3b + numArmnlow = 0x3c + numBali = 0x5 + numBeng = 0x6 + numBhks = 0x7 + numBrah = 0x8 + numCakm = 0x9 + numCham = 0xa + numCyrl = 0x3d + numDeva = 0xb + numEthi = 0x3e + numFullwide = 0xc + numGeor = 0x3f + numGonm = 0xd + numGrek = 0x40 + numGreklow = 0x41 + numGujr = 0xe + numGuru = 0xf + numHanidays = 0x42 + numHanidec = 0x43 + numHans = 0x44 + numHansfin = 0x45 + numHant = 0x46 + numHantfin = 0x47 + numHebr = 0x48 + numHmng = 0x10 + numJava = 0x11 + numJpan = 0x49 + numJpanfin = 0x4a + numKali = 0x12 + numKhmr = 0x13 + numKnda = 0x14 + numLana = 0x15 + numLanatham = 0x16 + numLaoo = 0x17 + numLatn = 0x0 + numLepc = 0x18 + numLimb = 0x19 + numMathbold = 0x1a + numMathdbl = 0x1b + numMathmono = 0x1c + numMathsanb = 0x1d + numMathsans = 0x1e + numMlym = 0x1f + numModi = 0x20 + numMong = 0x21 + numMroo = 0x22 + numMtei = 0x23 + numMymr = 0x24 + numMymrshan = 0x25 + numMymrtlng = 0x26 + numNewa = 0x27 + numNkoo = 0x28 + numOlck = 0x29 + numOrya = 0x2a + numOsma = 0x2b + numRoman = 0x4b + numRomanlow = 0x4c + numSaur = 0x2c + numShrd = 0x2d + numSind = 0x2e + numSinh = 0x2f + numSora = 0x30 + numSund = 0x31 + numTakr = 0x32 + numTalu = 0x33 + numTaml = 0x4d + numTamldec = 0x34 + numTelu = 0x35 + numThai = 0x36 + numTibt = 0x37 + numTirh = 0x38 + numVaii = 0x39 + numWara = 0x3a + numNumberSystems +) + +var systemMap = map[string]system{ + "adlm": numAdlm, + "ahom": numAhom, + "arab": numArab, + "arabext": numArabext, + "armn": numArmn, + "armnlow": numArmnlow, + "bali": numBali, + "beng": numBeng, + "bhks": numBhks, + "brah": numBrah, + "cakm": numCakm, + "cham": numCham, + "cyrl": numCyrl, + "deva": numDeva, + "ethi": numEthi, + "fullwide": numFullwide, + "geor": numGeor, + "gonm": numGonm, + "grek": numGrek, + "greklow": numGreklow, + "gujr": numGujr, + "guru": numGuru, + "hanidays": numHanidays, + "hanidec": numHanidec, + "hans": numHans, + "hansfin": numHansfin, + "hant": numHant, + "hantfin": numHantfin, + "hebr": numHebr, + "hmng": numHmng, + "java": numJava, + "jpan": numJpan, + "jpanfin": numJpanfin, + "kali": numKali, + "khmr": numKhmr, + "knda": numKnda, + "lana": numLana, + "lanatham": numLanatham, + "laoo": numLaoo, + "latn": numLatn, + "lepc": numLepc, + "limb": numLimb, + "mathbold": numMathbold, + "mathdbl": numMathdbl, + "mathmono": numMathmono, + "mathsanb": numMathsanb, + "mathsans": numMathsans, + "mlym": numMlym, + "modi": numModi, + "mong": numMong, + "mroo": numMroo, + "mtei": numMtei, + "mymr": numMymr, + "mymrshan": numMymrshan, + "mymrtlng": numMymrtlng, + "newa": numNewa, + "nkoo": numNkoo, + "olck": numOlck, + "orya": numOrya, + "osma": numOsma, + "roman": numRoman, + "romanlow": numRomanlow, + "saur": numSaur, + "shrd": numShrd, + "sind": numSind, + "sinh": numSinh, + "sora": numSora, + "sund": numSund, + "takr": numTakr, + "talu": numTalu, + "taml": numTaml, + "tamldec": numTamldec, + "telu": numTelu, + "thai": numThai, + "tibt": numTibt, + "tirh": numTirh, + "vaii": numVaii, + "wara": numWara, +} + +var symIndex = [][12]uint8{ // 81 elements + 0: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 1: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 2: [12]uint8{0x0, 0x1, 0x2, 0xd, 0xe, 0xf, 0x6, 0x7, 0x8, 0x9, 0x10, 0xb}, + 3: [12]uint8{0x1, 0x0, 0x2, 0xd, 0xe, 0xf, 0x6, 0x7, 0x8, 0x9, 0x10, 0xb}, + 4: [12]uint8{0x0, 0x1, 0x2, 0x11, 0xe, 0xf, 0x6, 0x7, 0x8, 0x9, 0x10, 0xb}, + 5: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x12, 0xb}, + 6: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 7: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x13, 0xb}, + 8: [12]uint8{0x0, 0x1, 0x2, 0x3, 0xe, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 9: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0x0}, + 10: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x6, 0x14, 0x8, 0x9, 0xa, 0xb}, + 11: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x14, 0x8, 0x9, 0xa, 0xb}, + 12: [12]uint8{0x0, 0x15, 0x2, 0x3, 0x4, 0x5, 0x6, 0x14, 0x8, 0x9, 0xa, 0xb}, + 13: [12]uint8{0x0, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 14: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x16, 0xb}, + 15: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x17, 0x7, 0x8, 0x9, 0xa, 0xb}, + 16: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x17, 0x7, 0x8, 0x9, 0xa, 0x0}, + 17: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x17, 0x7, 0x8, 0x9, 0xa, 0xb}, + 18: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0x0}, + 19: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x18, 0x7, 0x8, 0x9, 0xa, 0xb}, + 20: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x19, 0x1a, 0xa, 0xb}, + 21: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x1b, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 22: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x1b, 0x18, 0x7, 0x8, 0x9, 0xa, 0xb}, + 23: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x1b, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 24: [12]uint8{0x0, 0x1, 0x2, 0x3, 0xe, 0x1c, 0x6, 0x7, 0x8, 0x9, 0x1d, 0xb}, + 25: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x1b, 0x6, 0x7, 0x8, 0x9, 0x1e, 0x0}, + 26: [12]uint8{0x0, 0x15, 0x2, 0x3, 0x4, 0x1b, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 27: [12]uint8{0x0, 0x1, 0x2, 0x3, 0xe, 0xf, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 28: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x1f, 0xb}, + 29: [12]uint8{0x0, 0x15, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 30: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x20, 0xb}, + 31: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x21, 0x7, 0x8, 0x9, 0x22, 0xb}, + 32: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x23, 0xb}, + 33: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x1b, 0x18, 0x14, 0x8, 0x9, 0x24, 0xb}, + 34: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x1b, 0x18, 0x7, 0x8, 0x9, 0x24, 0xb}, + 35: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x25, 0xb}, + 36: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x26, 0xb}, + 37: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x27, 0xb}, + 38: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x28, 0xb}, + 39: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x29, 0xb}, + 40: [12]uint8{0x1, 0x0, 0x2, 0x3, 0xe, 0x1c, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 41: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x2a, 0xb}, + 42: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x2b, 0xb}, + 43: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x1b, 0x2c, 0x14, 0x8, 0x9, 0x24, 0xb}, + 44: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0x0}, + 45: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x17, 0x7, 0x8, 0x9, 0xa, 0xb}, + 46: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x1b, 0x17, 0x7, 0x8, 0x9, 0xa, 0xb}, + 47: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x2d, 0x0}, + 48: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x2e, 0xb}, + 49: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x2f, 0xb}, + 50: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x30, 0x7, 0x8, 0x9, 0xa, 0xb}, + 51: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x31, 0xb}, + 52: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x32, 0xb}, + 53: [12]uint8{0x1, 0x15, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 54: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x33, 0xb}, + 55: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x34, 0xb}, + 56: [12]uint8{0x35, 0x36, 0x37, 0x38, 0x39, 0x3a, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb}, + 57: [12]uint8{0x35, 0x36, 0x37, 0x38, 0x39, 0x3a, 0x3b, 0x7, 0x3c, 0x9, 0x3d, 0xb}, + 58: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x3e, 0x3f, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb}, + 59: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x39, 0x3a, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb}, + 60: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x39, 0x40, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb}, + 61: [12]uint8{0x35, 0x36, 0x37, 0x41, 0x3e, 0x3f, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb}, + 62: [12]uint8{0x35, 0x36, 0x37, 0x38, 0x3e, 0x3f, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb}, + 63: [12]uint8{0x35, 0xc, 0x37, 0x38, 0x39, 0x42, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0x0}, + 64: [12]uint8{0x35, 0xc, 0x37, 0x38, 0x39, 0x42, 0x43, 0x7, 0x44, 0x9, 0x24, 0xb}, + 65: [12]uint8{0x35, 0x36, 0x37, 0x38, 0x39, 0x5, 0x3b, 0x7, 0x3c, 0x9, 0x33, 0xb}, + 66: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x45, 0x46, 0x43, 0x7, 0x3c, 0x9, 0xa, 0x35}, + 67: [12]uint8{0x35, 0x36, 0x37, 0x11, 0xe, 0x1c, 0x43, 0x7, 0x3c, 0x9, 0x1d, 0xb}, + 68: [12]uint8{0x35, 0x36, 0x37, 0x11, 0xe, 0x1c, 0x43, 0x7, 0x3c, 0x9, 0xa, 0x35}, + 69: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x45, 0x5, 0x43, 0x7, 0x3c, 0x9, 0xa, 0x35}, + 70: [12]uint8{0x1, 0xc, 0x37, 0x11, 0x45, 0x47, 0x43, 0x7, 0x3c, 0x9, 0xa, 0x0}, + 71: [12]uint8{0x35, 0x1, 0x37, 0x11, 0x4, 0x5, 0x43, 0x7, 0x3c, 0x9, 0xa, 0x35}, + 72: [12]uint8{0x1, 0xc, 0x37, 0x11, 0x45, 0x47, 0x43, 0x7, 0x3c, 0x9, 0x24, 0xb}, + 73: [12]uint8{0x35, 0x36, 0x2, 0x3, 0x45, 0x46, 0x43, 0x7, 0x8, 0x9, 0xa, 0x35}, + 74: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x4, 0x5, 0x43, 0x7, 0x3c, 0x9, 0x31, 0x35}, + 75: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x4, 0x5, 0x43, 0x7, 0x3c, 0x9, 0x32, 0x35}, + 76: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x48, 0x46, 0x43, 0x7, 0x3c, 0x9, 0x33, 0x35}, + 77: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0x49}, + 78: [12]uint8{0x0, 0x1, 0x4a, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x28, 0xb}, + 79: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x4b, 0xb}, + 80: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x4c, 0x4d, 0xb}, +} // Size: 996 bytes + +var symData = stringset.Set{ + Data: "" + // Size: 599 bytes + ".,;%+-E׉∞NaN:\u00a0\u200e%\u200e\u200e+\u200e-ليس\u00a0رقمًا٪NDТерхьаш" + + "\u00a0дац·’mnne×10^0/00INF−\u200e−ناعددepälukuՈչԹარ\u00a0არის\u00a0რიცხვ" + + "იZMdMсан\u00a0емес¤¤¤сан\u00a0эмесບໍ່\u200bແມ່ນ\u200bໂຕ\u200bເລກNSဂဏန်" + + "းမဟုတ်သောННне\u00a0числочыыһыла\u00a0буотах·10^epilohosan\u00a0dälTFЕs" + + "on\u00a0emasҳақиқий\u00a0сон\u00a0эмас非數值非数值٫٬؛٪\u061c\u061c+\u061c-اس؉ل" + + "يس\u00a0رقم\u200f+\u200f-\u200f−٪\u200f\u061c−×۱۰^؉\u200f\u200e+\u200e" + + "\u200e-\u200e\u200e−\u200e+\u200e:၊ཨང་མེན་གྲངས་མེདཨང་མད", + Index: []uint16{ // 79 elements + // Entry 0 - 3F + 0x0000, 0x0001, 0x0002, 0x0003, 0x0004, 0x0005, 0x0006, 0x0007, + 0x0009, 0x000c, 0x000f, 0x0012, 0x0013, 0x0015, 0x001c, 0x0020, + 0x0024, 0x0036, 0x0038, 0x003a, 0x0050, 0x0052, 0x0055, 0x0058, + 0x0059, 0x005e, 0x0062, 0x0065, 0x0068, 0x006e, 0x0078, 0x0080, + 0x0086, 0x00ae, 0x00af, 0x00b2, 0x00c2, 0x00c8, 0x00d8, 0x0105, + 0x0107, 0x012e, 0x0132, 0x0142, 0x015e, 0x0163, 0x016a, 0x0173, + 0x0175, 0x0177, 0x0180, 0x01a0, 0x01a9, 0x01b2, 0x01b4, 0x01b6, + 0x01b8, 0x01bc, 0x01bf, 0x01c2, 0x01c6, 0x01c8, 0x01d6, 0x01da, + // Entry 40 - 7F + 0x01de, 0x01e4, 0x01e9, 0x01ee, 0x01f5, 0x01fa, 0x0201, 0x0208, + 0x0211, 0x0215, 0x0218, 0x021b, 0x0230, 0x0248, 0x0257, + }, +} // Size: 797 bytes + +// langToDefaults maps a compact language index to the default numbering system +// and default symbol set +var langToDefaults = [775]symOffset{ + // Entry 0 - 3F + 0x8000, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0000, 0x0000, + 0x0000, 0x0000, 0x8003, 0x0002, 0x0002, 0x0002, 0x0002, 0x0003, + 0x0002, 0x0002, 0x0002, 0x0002, 0x0002, 0x0002, 0x0002, 0x0002, + 0x0003, 0x0003, 0x0003, 0x0003, 0x0002, 0x0002, 0x0002, 0x0004, + 0x0002, 0x0004, 0x0002, 0x0002, 0x0002, 0x0003, 0x0002, 0x0000, + 0x8005, 0x0000, 0x0000, 0x0000, 0x8006, 0x0005, 0x0006, 0x0006, + 0x0006, 0x0006, 0x0006, 0x0001, 0x0001, 0x0001, 0x0001, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0000, 0x0000, + // Entry 40 - 7F + 0x8009, 0x0000, 0x0000, 0x800a, 0x0000, 0x0000, 0x800c, 0x0001, + 0x0000, 0x0000, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, + 0x0006, 0x0006, 0x0006, 0x0006, 0x800e, 0x0000, 0x0000, 0x0007, + 0x0007, 0x0000, 0x0000, 0x0000, 0x0000, 0x800f, 0x0008, 0x0008, + 0x8011, 0x0001, 0x0001, 0x0001, 0x803c, 0x0000, 0x0009, 0x0009, + 0x0009, 0x0000, 0x0000, 0x000a, 0x000b, 0x000a, 0x000c, 0x000a, + 0x000a, 0x000c, 0x000a, 0x000d, 0x000d, 0x000a, 0x000a, 0x0001, + 0x0001, 0x0000, 0x0001, 0x0001, 0x803f, 0x0000, 0x0000, 0x0000, + // Entry 80 - BF + 0x000e, 0x000e, 0x000e, 0x000f, 0x000f, 0x000f, 0x0000, 0x0000, + 0x0006, 0x0000, 0x0000, 0x0000, 0x000a, 0x0010, 0x0000, 0x0006, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0011, 0x0000, 0x000a, + 0x0000, 0x0000, 0x0000, 0x0000, 0x000a, 0x0000, 0x0009, 0x0000, + 0x0000, 0x0012, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + // Entry C0 - FF + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0013, 0x0000, + 0x0000, 0x000f, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0001, 0x0000, 0x0000, 0x0015, + 0x0015, 0x0006, 0x0000, 0x0006, 0x0006, 0x0000, 0x0000, 0x0006, + 0x0006, 0x0001, 0x0000, 0x0000, 0x0006, 0x0006, 0x0006, 0x0006, + // Entry 100 - 13F + 0x0000, 0x0000, 0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0006, + 0x0000, 0x0006, 0x0000, 0x0000, 0x0006, 0x0006, 0x0016, 0x0016, + 0x0017, 0x0017, 0x0001, 0x0001, 0x8041, 0x0018, 0x0018, 0x0001, + 0x0001, 0x0001, 0x0001, 0x0001, 0x0019, 0x0019, 0x0000, 0x0000, + 0x0017, 0x0017, 0x0017, 0x8044, 0x0001, 0x0001, 0x0001, 0x0001, + 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, + 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, + 0x0001, 0x0001, 0x0006, 0x0006, 0x0001, 0x0001, 0x0001, 0x0001, + // Entry 140 - 17F + 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, + 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, + 0x0001, 0x0001, 0x0006, 0x0006, 0x0006, 0x0006, 0x0000, 0x0000, + 0x8047, 0x0000, 0x0006, 0x0006, 0x001a, 0x001a, 0x001a, 0x001a, + 0x804a, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x804c, 0x001b, 0x0000, + 0x0000, 0x0006, 0x0006, 0x0006, 0x000a, 0x000a, 0x0001, 0x0001, + 0x001c, 0x001c, 0x0009, 0x0009, 0x804f, 0x0000, 0x0000, 0x0000, + // Entry 180 - 1BF + 0x0000, 0x0000, 0x8052, 0x0006, 0x0006, 0x001d, 0x0006, 0x0006, + 0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0006, 0x0006, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x001e, 0x001e, 0x001f, + 0x001f, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0001, + 0x0001, 0x000d, 0x000d, 0x0000, 0x0000, 0x0020, 0x0020, 0x0006, + 0x0006, 0x0021, 0x0021, 0x0000, 0x0000, 0x0006, 0x0006, 0x0000, + 0x0000, 0x8054, 0x0000, 0x0000, 0x0000, 0x0000, 0x8056, 0x001b, + 0x0000, 0x0000, 0x0001, 0x0001, 0x0022, 0x0022, 0x0000, 0x0000, + // Entry 1C0 - 1FF + 0x0000, 0x0023, 0x0023, 0x0000, 0x0000, 0x0006, 0x0006, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, + 0x0024, 0x0024, 0x8058, 0x0000, 0x0000, 0x0016, 0x0016, 0x0006, + 0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0025, 0x0025, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x000d, 0x000d, 0x0000, 0x0000, + 0x0006, 0x0006, 0x0000, 0x0000, 0x0006, 0x0006, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x805a, 0x0000, 0x0000, 0x0006, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0006, 0x0006, 0x805b, 0x0026, 0x805d, + // Entry 200 - 23F + 0x0000, 0x0000, 0x0000, 0x0000, 0x805e, 0x0015, 0x0015, 0x0000, + 0x0000, 0x0006, 0x0006, 0x0006, 0x8061, 0x0000, 0x0000, 0x8062, + 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0001, + 0x0001, 0x0015, 0x0015, 0x0006, 0x0006, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0027, 0x0027, 0x0027, 0x8065, 0x8067, + 0x001b, 0x0000, 0x0000, 0x0000, 0x0001, 0x0001, 0x0001, 0x0001, + 0x8069, 0x0028, 0x0006, 0x0001, 0x0006, 0x0001, 0x0001, 0x0001, + // Entry 240 - 27F + 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0000, + 0x0006, 0x0000, 0x0000, 0x001a, 0x001a, 0x0006, 0x0006, 0x0006, + 0x0006, 0x0006, 0x0000, 0x0000, 0x0029, 0x0029, 0x0029, 0x0029, + 0x0029, 0x0029, 0x0029, 0x0006, 0x0006, 0x0000, 0x0000, 0x002a, + 0x002a, 0x0000, 0x0000, 0x0000, 0x0000, 0x806b, 0x0000, 0x0000, + 0x002b, 0x002b, 0x002b, 0x002b, 0x0006, 0x0006, 0x000d, 0x000d, + 0x0006, 0x0006, 0x0000, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, + 0x002c, 0x002c, 0x002d, 0x002d, 0x002e, 0x002e, 0x0000, 0x0000, + // Entry 280 - 2BF + 0x0000, 0x002f, 0x002f, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0001, 0x0001, 0x0001, 0x0001, 0x0006, + 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, + 0x0006, 0x0006, 0x0000, 0x0000, 0x0000, 0x806d, 0x0022, 0x0022, + 0x0022, 0x0000, 0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0001, 0x0001, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0030, 0x0030, 0x0000, 0x0000, 0x8071, 0x0031, 0x0006, + // Entry 2C0 - 2FF + 0x0006, 0x0006, 0x0000, 0x0001, 0x0001, 0x000d, 0x000d, 0x0001, + 0x0001, 0x0000, 0x0000, 0x0032, 0x0032, 0x8074, 0x8076, 0x001b, + 0x8077, 0x8079, 0x0028, 0x807b, 0x0034, 0x0033, 0x0033, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0006, 0x0006, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0035, 0x0035, 0x0006, 0x0006, + 0x0000, 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0036, 0x0037, 0x0037, 0x0036, 0x0036, 0x0001, + 0x0001, 0x807d, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x8080, + // Entry 300 - 33F + 0x0036, 0x0036, 0x0036, 0x0000, 0x0000, 0x0006, 0x0014, +} // Size: 1550 bytes + +// langToAlt is a list of numbering system and symbol set pairs, sorted and +// marked by compact language index. +var langToAlt = []altSymData{ // 131 elements + 1: {compactTag: 0x0, symIndex: 0x38, system: 0x3}, + 2: {compactTag: 0x0, symIndex: 0x42, system: 0x4}, + 3: {compactTag: 0xa, symIndex: 0x39, system: 0x3}, + 4: {compactTag: 0xa, symIndex: 0x2, system: 0x0}, + 5: {compactTag: 0x28, symIndex: 0x0, system: 0x6}, + 6: {compactTag: 0x2c, symIndex: 0x5, system: 0x0}, + 7: {compactTag: 0x2c, symIndex: 0x3a, system: 0x3}, + 8: {compactTag: 0x2c, symIndex: 0x42, system: 0x4}, + 9: {compactTag: 0x40, symIndex: 0x0, system: 0x6}, + 10: {compactTag: 0x43, symIndex: 0x0, system: 0x0}, + 11: {compactTag: 0x43, symIndex: 0x4f, system: 0x37}, + 12: {compactTag: 0x46, symIndex: 0x1, system: 0x0}, + 13: {compactTag: 0x46, symIndex: 0x38, system: 0x3}, + 14: {compactTag: 0x54, symIndex: 0x0, system: 0x9}, + 15: {compactTag: 0x5d, symIndex: 0x3a, system: 0x3}, + 16: {compactTag: 0x5d, symIndex: 0x8, system: 0x0}, + 17: {compactTag: 0x60, symIndex: 0x1, system: 0x0}, + 18: {compactTag: 0x60, symIndex: 0x38, system: 0x3}, + 19: {compactTag: 0x60, symIndex: 0x42, system: 0x4}, + 20: {compactTag: 0x60, symIndex: 0x0, system: 0x5}, + 21: {compactTag: 0x60, symIndex: 0x0, system: 0x6}, + 22: {compactTag: 0x60, symIndex: 0x0, system: 0x8}, + 23: {compactTag: 0x60, symIndex: 0x0, system: 0x9}, + 24: {compactTag: 0x60, symIndex: 0x0, system: 0xa}, + 25: {compactTag: 0x60, symIndex: 0x0, system: 0xb}, + 26: {compactTag: 0x60, symIndex: 0x0, system: 0xc}, + 27: {compactTag: 0x60, symIndex: 0x0, system: 0xd}, + 28: {compactTag: 0x60, symIndex: 0x0, system: 0xe}, + 29: {compactTag: 0x60, symIndex: 0x0, system: 0xf}, + 30: {compactTag: 0x60, symIndex: 0x0, system: 0x11}, + 31: {compactTag: 0x60, symIndex: 0x0, system: 0x12}, + 32: {compactTag: 0x60, symIndex: 0x0, system: 0x13}, + 33: {compactTag: 0x60, symIndex: 0x0, system: 0x14}, + 34: {compactTag: 0x60, symIndex: 0x0, system: 0x15}, + 35: {compactTag: 0x60, symIndex: 0x0, system: 0x16}, + 36: {compactTag: 0x60, symIndex: 0x0, system: 0x17}, + 37: {compactTag: 0x60, symIndex: 0x0, system: 0x18}, + 38: {compactTag: 0x60, symIndex: 0x0, system: 0x19}, + 39: {compactTag: 0x60, symIndex: 0x0, system: 0x1f}, + 40: {compactTag: 0x60, symIndex: 0x0, system: 0x21}, + 41: {compactTag: 0x60, symIndex: 0x0, system: 0x23}, + 42: {compactTag: 0x60, symIndex: 0x0, system: 0x24}, + 43: {compactTag: 0x60, symIndex: 0x0, system: 0x25}, + 44: {compactTag: 0x60, symIndex: 0x0, system: 0x28}, + 45: {compactTag: 0x60, symIndex: 0x0, system: 0x29}, + 46: {compactTag: 0x60, symIndex: 0x0, system: 0x2a}, + 47: {compactTag: 0x60, symIndex: 0x0, system: 0x2b}, + 48: {compactTag: 0x60, symIndex: 0x0, system: 0x2c}, + 49: {compactTag: 0x60, symIndex: 0x0, system: 0x2d}, + 50: {compactTag: 0x60, symIndex: 0x0, system: 0x30}, + 51: {compactTag: 0x60, symIndex: 0x0, system: 0x31}, + 52: {compactTag: 0x60, symIndex: 0x0, system: 0x32}, + 53: {compactTag: 0x60, symIndex: 0x0, system: 0x33}, + 54: {compactTag: 0x60, symIndex: 0x0, system: 0x34}, + 55: {compactTag: 0x60, symIndex: 0x0, system: 0x35}, + 56: {compactTag: 0x60, symIndex: 0x0, system: 0x36}, + 57: {compactTag: 0x60, symIndex: 0x0, system: 0x37}, + 58: {compactTag: 0x60, symIndex: 0x0, system: 0x39}, + 59: {compactTag: 0x60, symIndex: 0x0, system: 0x43}, + 60: {compactTag: 0x64, symIndex: 0x0, system: 0x0}, + 61: {compactTag: 0x64, symIndex: 0x38, system: 0x3}, + 62: {compactTag: 0x64, symIndex: 0x42, system: 0x4}, + 63: {compactTag: 0x7c, symIndex: 0x50, system: 0x37}, + 64: {compactTag: 0x7c, symIndex: 0x0, system: 0x0}, + 65: {compactTag: 0x114, symIndex: 0x43, system: 0x4}, + 66: {compactTag: 0x114, symIndex: 0x18, system: 0x0}, + 67: {compactTag: 0x114, symIndex: 0x3b, system: 0x3}, + 68: {compactTag: 0x123, symIndex: 0x1, system: 0x0}, + 69: {compactTag: 0x123, symIndex: 0x3c, system: 0x3}, + 70: {compactTag: 0x123, symIndex: 0x44, system: 0x4}, + 71: {compactTag: 0x158, symIndex: 0x0, system: 0x0}, + 72: {compactTag: 0x158, symIndex: 0x3b, system: 0x3}, + 73: {compactTag: 0x158, symIndex: 0x45, system: 0x4}, + 74: {compactTag: 0x160, symIndex: 0x0, system: 0x0}, + 75: {compactTag: 0x160, symIndex: 0x38, system: 0x3}, + 76: {compactTag: 0x16d, symIndex: 0x1b, system: 0x0}, + 77: {compactTag: 0x16d, symIndex: 0x0, system: 0x9}, + 78: {compactTag: 0x16d, symIndex: 0x0, system: 0xa}, + 79: {compactTag: 0x17c, symIndex: 0x0, system: 0x0}, + 80: {compactTag: 0x17c, symIndex: 0x3d, system: 0x3}, + 81: {compactTag: 0x17c, symIndex: 0x42, system: 0x4}, + 82: {compactTag: 0x182, symIndex: 0x6, system: 0x0}, + 83: {compactTag: 0x182, symIndex: 0x38, system: 0x3}, + 84: {compactTag: 0x1b1, symIndex: 0x0, system: 0x0}, + 85: {compactTag: 0x1b1, symIndex: 0x3e, system: 0x3}, + 86: {compactTag: 0x1b6, symIndex: 0x42, system: 0x4}, + 87: {compactTag: 0x1b6, symIndex: 0x1b, system: 0x0}, + 88: {compactTag: 0x1d2, symIndex: 0x42, system: 0x4}, + 89: {compactTag: 0x1d2, symIndex: 0x0, system: 0x0}, + 90: {compactTag: 0x1f3, symIndex: 0x0, system: 0xb}, + 91: {compactTag: 0x1fd, symIndex: 0x4e, system: 0x24}, + 92: {compactTag: 0x1fd, symIndex: 0x26, system: 0x0}, + 93: {compactTag: 0x1ff, symIndex: 0x42, system: 0x4}, + 94: {compactTag: 0x204, symIndex: 0x15, system: 0x0}, + 95: {compactTag: 0x204, symIndex: 0x3f, system: 0x3}, + 96: {compactTag: 0x204, symIndex: 0x46, system: 0x4}, + 97: {compactTag: 0x20c, symIndex: 0x0, system: 0xb}, + 98: {compactTag: 0x20f, symIndex: 0x6, system: 0x0}, + 99: {compactTag: 0x20f, symIndex: 0x38, system: 0x3}, + 100: {compactTag: 0x20f, symIndex: 0x42, system: 0x4}, + 101: {compactTag: 0x22e, symIndex: 0x0, system: 0x0}, + 102: {compactTag: 0x22e, symIndex: 0x47, system: 0x4}, + 103: {compactTag: 0x22f, symIndex: 0x42, system: 0x4}, + 104: {compactTag: 0x22f, symIndex: 0x1b, system: 0x0}, + 105: {compactTag: 0x238, symIndex: 0x42, system: 0x4}, + 106: {compactTag: 0x238, symIndex: 0x28, system: 0x0}, + 107: {compactTag: 0x265, symIndex: 0x38, system: 0x3}, + 108: {compactTag: 0x265, symIndex: 0x0, system: 0x0}, + 109: {compactTag: 0x29d, symIndex: 0x22, system: 0x0}, + 110: {compactTag: 0x29d, symIndex: 0x40, system: 0x3}, + 111: {compactTag: 0x29d, symIndex: 0x48, system: 0x4}, + 112: {compactTag: 0x29d, symIndex: 0x4d, system: 0xc}, + 113: {compactTag: 0x2bd, symIndex: 0x31, system: 0x0}, + 114: {compactTag: 0x2bd, symIndex: 0x3e, system: 0x3}, + 115: {compactTag: 0x2bd, symIndex: 0x42, system: 0x4}, + 116: {compactTag: 0x2cd, symIndex: 0x1b, system: 0x0}, + 117: {compactTag: 0x2cd, symIndex: 0x49, system: 0x4}, + 118: {compactTag: 0x2ce, symIndex: 0x49, system: 0x4}, + 119: {compactTag: 0x2d0, symIndex: 0x33, system: 0x0}, + 120: {compactTag: 0x2d0, symIndex: 0x4a, system: 0x4}, + 121: {compactTag: 0x2d1, symIndex: 0x42, system: 0x4}, + 122: {compactTag: 0x2d1, symIndex: 0x28, system: 0x0}, + 123: {compactTag: 0x2d3, symIndex: 0x34, system: 0x0}, + 124: {compactTag: 0x2d3, symIndex: 0x4b, system: 0x4}, + 125: {compactTag: 0x2f9, symIndex: 0x0, system: 0x0}, + 126: {compactTag: 0x2f9, symIndex: 0x38, system: 0x3}, + 127: {compactTag: 0x2f9, symIndex: 0x42, system: 0x4}, + 128: {compactTag: 0x2ff, symIndex: 0x36, system: 0x0}, + 129: {compactTag: 0x2ff, symIndex: 0x41, system: 0x3}, + 130: {compactTag: 0x2ff, symIndex: 0x4c, system: 0x4}, +} // Size: 810 bytes + +var tagToDecimal = []uint8{ // 775 elements + // Entry 0 - 3F + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 40 - 7F + 0x05, 0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x05, 0x05, 0x05, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x05, 0x05, 0x01, 0x01, + // Entry 80 - BF + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry C0 - FF + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 100 - 13F + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 140 - 17F + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x05, + 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 180 - 1BF + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x05, 0x05, 0x05, 0x05, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 1C0 - 1FF + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x05, 0x05, + 0x01, 0x01, 0x01, 0x05, 0x05, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 200 - 23F + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x05, 0x05, 0x01, 0x01, 0x01, 0x05, 0x01, + 0x01, 0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 240 - 27F + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 280 - 2BF + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x05, + 0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 2C0 - 2FF + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 300 - 33F + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x08, +} // Size: 799 bytes + +var tagToScientific = []uint8{ // 775 elements + // Entry 0 - 3F + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 40 - 7F + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 80 - BF + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry C0 - FF + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 100 - 13F + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 140 - 17F + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x0c, 0x0c, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x0c, + 0x0c, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 180 - 1BF + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 1C0 - 1FF + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x0d, 0x0d, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x0c, 0x0c, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 200 - 23F + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x0c, 0x02, + 0x02, 0x0c, 0x0c, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 240 - 27F + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x0d, 0x0d, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 280 - 2BF + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 2C0 - 2FF + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 300 - 33F + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x09, +} // Size: 799 bytes + +var tagToPercent = []uint8{ // 775 elements + // Entry 0 - 3F + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x06, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x03, 0x03, 0x03, 0x03, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + // Entry 40 - 7F + 0x06, 0x06, 0x06, 0x04, 0x04, 0x04, 0x03, 0x03, + 0x06, 0x06, 0x03, 0x04, 0x04, 0x03, 0x03, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x06, 0x06, 0x06, 0x03, + 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, + 0x03, 0x04, 0x04, 0x03, 0x03, 0x03, 0x04, 0x03, + 0x03, 0x04, 0x03, 0x04, 0x04, 0x03, 0x03, 0x03, + 0x03, 0x04, 0x04, 0x04, 0x07, 0x07, 0x04, 0x04, + // Entry 80 - BF + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x03, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x03, 0x04, 0x03, 0x04, + 0x04, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + // Entry C0 - FF + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + // Entry 100 - 13F + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x04, 0x04, + 0x0b, 0x0b, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04, 0x04, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x04, 0x03, 0x03, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + // Entry 140 - 17F + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x06, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x06, + 0x06, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + // Entry 180 - 1BF + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x06, 0x06, 0x06, 0x06, + 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04, 0x04, + // Entry 1C0 - 1FF + 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + // Entry 200 - 23F + 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x03, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x06, 0x06, 0x04, 0x04, 0x04, 0x06, 0x04, + 0x04, 0x06, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + // Entry 240 - 27F + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x04, 0x04, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x03, 0x03, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x03, 0x03, 0x03, 0x03, 0x04, 0x04, + // Entry 280 - 2BF + 0x04, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x03, + 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x06, + 0x06, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x0e, + // Entry 2C0 - 2FF + 0x0e, 0x0e, 0x04, 0x03, 0x03, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, + 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + // Entry 300 - 33F + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x0a, +} // Size: 799 bytes + +var formats = []Pattern{Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x0, + MinIntegerDigits: 0x0, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x0, + GroupingSize: [2]uint8{0x0, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 3, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x0, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x9, + GroupingSize: [2]uint8{0x3, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x0, + MinIntegerDigits: 0x0, + MaxIntegerDigits: 0x1, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x1}, + Affix: "", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x3, + GroupingSize: [2]uint8{0x0, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x2, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "\x00\x03\u00a0%", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x7, + GroupingSize: [2]uint8{0x3, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x2, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "\x00\x01%", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x6, + GroupingSize: [2]uint8{0x3, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 3, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x0, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0xc, + GroupingSize: [2]uint8{0x3, + 0x2}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x2, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "\x00\x01%", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x9, + GroupingSize: [2]uint8{0x3, + 0x2}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x2, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "\x00\x03\u00a0%", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0xa, + GroupingSize: [2]uint8{0x3, + 0x2}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 6, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x0, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x8, + GroupingSize: [2]uint8{0x0, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 6, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x0, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x6, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x3}, + Affix: "", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0xd, + GroupingSize: [2]uint8{0x0, + 0x0}, + Flags: 0x4}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x2, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "\x00\x01%", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x2, + GroupingSize: [2]uint8{0x0, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x2, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "\x03%\u00a0\x00", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x7, + GroupingSize: [2]uint8{0x3, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x0, + MinIntegerDigits: 0x0, + MaxIntegerDigits: 0x1, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x1}, + Affix: "\x01[\x01]", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x5, + GroupingSize: [2]uint8{0x0, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x0, + MinIntegerDigits: 0x0, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x1, + GroupingSize: [2]uint8{0x0, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x2, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "\x01%\x00", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x6, + GroupingSize: [2]uint8{0x3, + 0x0}, + Flags: 0x0}} + +// Total table size 8634 bytes (8KiB); checksum: 8F23386D diff --git a/vendor/golang.org/x/text/internal/stringset/set.go b/vendor/golang.org/x/text/internal/stringset/set.go new file mode 100644 index 0000000..bb2fffb --- /dev/null +++ b/vendor/golang.org/x/text/internal/stringset/set.go @@ -0,0 +1,86 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package stringset provides a way to represent a collection of strings +// compactly. +package stringset + +import "sort" + +// A Set holds a collection of strings that can be looked up by an index number. +type Set struct { + // These fields are exported to allow for code generation. + + Data string + Index []uint16 +} + +// Elem returns the string with index i. It panics if i is out of range. +func (s *Set) Elem(i int) string { + return s.Data[s.Index[i]:s.Index[i+1]] +} + +// Len returns the number of strings in the set. +func (s *Set) Len() int { + return len(s.Index) - 1 +} + +// Search returns the index of the given string or -1 if it is not in the set. +// The Set must have been created with strings in sorted order. +func Search(s *Set, str string) int { + // TODO: optimize this if it gets used a lot. + n := len(s.Index) - 1 + p := sort.Search(n, func(i int) bool { + return s.Elem(i) >= str + }) + if p == n || str != s.Elem(p) { + return -1 + } + return p +} + +// A Builder constructs Sets. +type Builder struct { + set Set + index map[string]int +} + +// NewBuilder returns a new and initialized Builder. +func NewBuilder() *Builder { + return &Builder{ + set: Set{ + Index: []uint16{0}, + }, + index: map[string]int{}, + } +} + +// Set creates the set created so far. +func (b *Builder) Set() Set { + return b.set +} + +// Index returns the index for the given string, which must have been added +// before. +func (b *Builder) Index(s string) int { + return b.index[s] +} + +// Add adds a string to the index. Strings that are added by a single Add will +// be stored together, unless they match an existing string. +func (b *Builder) Add(ss ...string) { + // First check if the string already exists. + for _, s := range ss { + if _, ok := b.index[s]; ok { + continue + } + b.index[s] = len(b.set.Index) - 1 + b.set.Data += s + x := len(b.set.Data) + if x > 0xFFFF { + panic("Index too > 0xFFFF") + } + b.set.Index = append(b.set.Index, uint16(x)) + } +} diff --git a/vendor/golang.org/x/text/internal/tag/tag.go b/vendor/golang.org/x/text/internal/tag/tag.go new file mode 100644 index 0000000..b5d3488 --- /dev/null +++ b/vendor/golang.org/x/text/internal/tag/tag.go @@ -0,0 +1,100 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package tag contains functionality handling tags and related data. +package tag // import "golang.org/x/text/internal/tag" + +import "sort" + +// An Index converts tags to a compact numeric value. +// +// All elements are of size 4. Tags may be up to 4 bytes long. Excess bytes can +// be used to store additional information about the tag. +type Index string + +// Elem returns the element data at the given index. +func (s Index) Elem(x int) string { + return string(s[x*4 : x*4+4]) +} + +// Index reports the index of the given key or -1 if it could not be found. +// Only the first len(key) bytes from the start of the 4-byte entries will be +// considered for the search and the first match in Index will be returned. +func (s Index) Index(key []byte) int { + n := len(key) + // search the index of the first entry with an equal or higher value than + // key in s. + index := sort.Search(len(s)/4, func(i int) bool { + return cmp(s[i*4:i*4+n], key) != -1 + }) + i := index * 4 + if cmp(s[i:i+len(key)], key) != 0 { + return -1 + } + return index +} + +// Next finds the next occurrence of key after index x, which must have been +// obtained from a call to Index using the same key. It returns x+1 or -1. +func (s Index) Next(key []byte, x int) int { + if x++; x*4 < len(s) && cmp(s[x*4:x*4+len(key)], key) == 0 { + return x + } + return -1 +} + +// cmp returns an integer comparing a and b lexicographically. +func cmp(a Index, b []byte) int { + n := len(a) + if len(b) < n { + n = len(b) + } + for i, c := range b[:n] { + switch { + case a[i] > c: + return 1 + case a[i] < c: + return -1 + } + } + switch { + case len(a) < len(b): + return -1 + case len(a) > len(b): + return 1 + } + return 0 +} + +// Compare returns an integer comparing a and b lexicographically. +func Compare(a string, b []byte) int { + return cmp(Index(a), b) +} + +// FixCase reformats b to the same pattern of cases as form. +// If returns false if string b is malformed. +func FixCase(form string, b []byte) bool { + if len(form) != len(b) { + return false + } + for i, c := range b { + if form[i] <= 'Z' { + if c >= 'a' { + c -= 'z' - 'Z' + } + if c < 'A' || 'Z' < c { + return false + } + } else { + if c <= 'Z' { + c += 'z' - 'Z' + } + if c < 'a' || 'z' < c { + return false + } + } + b[i] = c + } + return true +} diff --git a/vendor/golang.org/x/text/language/coverage.go b/vendor/golang.org/x/text/language/coverage.go new file mode 100644 index 0000000..a24fd1a --- /dev/null +++ b/vendor/golang.org/x/text/language/coverage.go @@ -0,0 +1,187 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "fmt" + "sort" + + "golang.org/x/text/internal/language" +) + +// The Coverage interface is used to define the level of coverage of an +// internationalization service. Note that not all types are supported by all +// services. As lists may be generated on the fly, it is recommended that users +// of a Coverage cache the results. +type Coverage interface { + // Tags returns the list of supported tags. + Tags() []Tag + + // BaseLanguages returns the list of supported base languages. + BaseLanguages() []Base + + // Scripts returns the list of supported scripts. + Scripts() []Script + + // Regions returns the list of supported regions. + Regions() []Region +} + +var ( + // Supported defines a Coverage that lists all supported subtags. Tags + // always returns nil. + Supported Coverage = allSubtags{} +) + +// TODO: +// - Support Variants, numbering systems. +// - CLDR coverage levels. +// - Set of common tags defined in this package. + +type allSubtags struct{} + +// Regions returns the list of supported regions. As all regions are in a +// consecutive range, it simply returns a slice of numbers in increasing order. +// The "undefined" region is not returned. +func (s allSubtags) Regions() []Region { + reg := make([]Region, language.NumRegions) + for i := range reg { + reg[i] = Region{language.Region(i + 1)} + } + return reg +} + +// Scripts returns the list of supported scripts. As all scripts are in a +// consecutive range, it simply returns a slice of numbers in increasing order. +// The "undefined" script is not returned. +func (s allSubtags) Scripts() []Script { + scr := make([]Script, language.NumScripts) + for i := range scr { + scr[i] = Script{language.Script(i + 1)} + } + return scr +} + +// BaseLanguages returns the list of all supported base languages. It generates +// the list by traversing the internal structures. +func (s allSubtags) BaseLanguages() []Base { + bs := language.BaseLanguages() + base := make([]Base, len(bs)) + for i, b := range bs { + base[i] = Base{b} + } + return base +} + +// Tags always returns nil. +func (s allSubtags) Tags() []Tag { + return nil +} + +// coverage is used by NewCoverage which is used as a convenient way for +// creating Coverage implementations for partially defined data. Very often a +// package will only need to define a subset of slices. coverage provides a +// convenient way to do this. Moreover, packages using NewCoverage, instead of +// their own implementation, will not break if later new slice types are added. +type coverage struct { + tags func() []Tag + bases func() []Base + scripts func() []Script + regions func() []Region +} + +func (s *coverage) Tags() []Tag { + if s.tags == nil { + return nil + } + return s.tags() +} + +// bases implements sort.Interface and is used to sort base languages. +type bases []Base + +func (b bases) Len() int { + return len(b) +} + +func (b bases) Swap(i, j int) { + b[i], b[j] = b[j], b[i] +} + +func (b bases) Less(i, j int) bool { + return b[i].langID < b[j].langID +} + +// BaseLanguages returns the result from calling s.bases if it is specified or +// otherwise derives the set of supported base languages from tags. +func (s *coverage) BaseLanguages() []Base { + if s.bases == nil { + tags := s.Tags() + if len(tags) == 0 { + return nil + } + a := make([]Base, len(tags)) + for i, t := range tags { + a[i] = Base{language.Language(t.lang())} + } + sort.Sort(bases(a)) + k := 0 + for i := 1; i < len(a); i++ { + if a[k] != a[i] { + k++ + a[k] = a[i] + } + } + return a[:k+1] + } + return s.bases() +} + +func (s *coverage) Scripts() []Script { + if s.scripts == nil { + return nil + } + return s.scripts() +} + +func (s *coverage) Regions() []Region { + if s.regions == nil { + return nil + } + return s.regions() +} + +// NewCoverage returns a Coverage for the given lists. It is typically used by +// packages providing internationalization services to define their level of +// coverage. A list may be of type []T or func() []T, where T is either Tag, +// Base, Script or Region. The returned Coverage derives the value for Bases +// from Tags if no func or slice for []Base is specified. For other unspecified +// types the returned Coverage will return nil for the respective methods. +func NewCoverage(list ...interface{}) Coverage { + s := &coverage{} + for _, x := range list { + switch v := x.(type) { + case func() []Base: + s.bases = v + case func() []Script: + s.scripts = v + case func() []Region: + s.regions = v + case func() []Tag: + s.tags = v + case []Base: + s.bases = func() []Base { return v } + case []Script: + s.scripts = func() []Script { return v } + case []Region: + s.regions = func() []Region { return v } + case []Tag: + s.tags = func() []Tag { return v } + default: + panic(fmt.Sprintf("language: unsupported set type %T", v)) + } + } + return s +} diff --git a/vendor/golang.org/x/text/language/doc.go b/vendor/golang.org/x/text/language/doc.go new file mode 100644 index 0000000..212b77c --- /dev/null +++ b/vendor/golang.org/x/text/language/doc.go @@ -0,0 +1,98 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package language implements BCP 47 language tags and related functionality. +// +// The most important function of package language is to match a list of +// user-preferred languages to a list of supported languages. +// It alleviates the developer of dealing with the complexity of this process +// and provides the user with the best experience +// (see https://blog.golang.org/matchlang). +// +// # Matching preferred against supported languages +// +// A Matcher for an application that supports English, Australian English, +// Danish, and standard Mandarin can be created as follows: +// +// var matcher = language.NewMatcher([]language.Tag{ +// language.English, // The first language is used as fallback. +// language.MustParse("en-AU"), +// language.Danish, +// language.Chinese, +// }) +// +// This list of supported languages is typically implied by the languages for +// which there exists translations of the user interface. +// +// User-preferred languages usually come as a comma-separated list of BCP 47 +// language tags. +// The MatchString finds best matches for such strings: +// +// handler(w http.ResponseWriter, r *http.Request) { +// lang, _ := r.Cookie("lang") +// accept := r.Header.Get("Accept-Language") +// tag, _ := language.MatchStrings(matcher, lang.String(), accept) +// +// // tag should now be used for the initialization of any +// // locale-specific service. +// } +// +// The Matcher's Match method can be used to match Tags directly. +// +// Matchers are aware of the intricacies of equivalence between languages, such +// as deprecated subtags, legacy tags, macro languages, mutual +// intelligibility between scripts and languages, and transparently passing +// BCP 47 user configuration. +// For instance, it will know that a reader of Bokmål Danish can read Norwegian +// and will know that Cantonese ("yue") is a good match for "zh-HK". +// +// # Using match results +// +// To guarantee a consistent user experience to the user it is important to +// use the same language tag for the selection of any locale-specific services. +// For example, it is utterly confusing to substitute spelled-out numbers +// or dates in one language in text of another language. +// More subtly confusing is using the wrong sorting order or casing +// algorithm for a certain language. +// +// All the packages in x/text that provide locale-specific services +// (e.g. collate, cases) should be initialized with the tag that was +// obtained at the start of an interaction with the user. +// +// Note that Tag that is returned by Match and MatchString may differ from any +// of the supported languages, as it may contain carried over settings from +// the user tags. +// This may be inconvenient when your application has some additional +// locale-specific data for your supported languages. +// Match and MatchString both return the index of the matched supported tag +// to simplify associating such data with the matched tag. +// +// # Canonicalization +// +// If one uses the Matcher to compare languages one does not need to +// worry about canonicalization. +// +// The meaning of a Tag varies per application. The language package +// therefore delays canonicalization and preserves information as much +// as possible. The Matcher, however, will always take into account that +// two different tags may represent the same language. +// +// By default, only legacy and deprecated tags are converted into their +// canonical equivalent. All other information is preserved. This approach makes +// the confidence scores more accurate and allows matchers to distinguish +// between variants that are otherwise lost. +// +// As a consequence, two tags that should be treated as identical according to +// BCP 47 or CLDR, like "en-Latn" and "en", will be represented differently. The +// Matcher handles such distinctions, though, and is aware of the +// equivalence relations. The CanonType type can be used to alter the +// canonicalization form. +// +// # References +// +// BCP 47 - Tags for Identifying Languages http://tools.ietf.org/html/bcp47 +package language // import "golang.org/x/text/language" + +// TODO: explanation on how to match languages for your own locale-specific +// service. diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go new file mode 100644 index 0000000..4d9c661 --- /dev/null +++ b/vendor/golang.org/x/text/language/language.go @@ -0,0 +1,605 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go -output tables.go + +package language + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "strings" + + "golang.org/x/text/internal/language" + "golang.org/x/text/internal/language/compact" +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. +type Tag compact.Tag + +func makeTag(t language.Tag) (tag Tag) { + return Tag(compact.Make(t)) +} + +func (t *Tag) tag() language.Tag { + return (*compact.Tag)(t).Tag() +} + +func (t *Tag) isCompact() bool { + return (*compact.Tag)(t).IsCompact() +} + +// TODO: improve performance. +func (t *Tag) lang() language.Language { return t.tag().LangID } +func (t *Tag) region() language.Region { return t.tag().RegionID } +func (t *Tag) script() language.Script { return t.tag().ScriptID } + +// Make is a convenience wrapper for Parse that omits the error. +// In case of an error, a sensible default is returned. +func Make(s string) Tag { + return Default.Make(s) +} + +// Make is a convenience wrapper for c.Parse that omits the error. +// In case of an error, a sensible default is returned. +func (c CanonType) Make(s string) Tag { + t, _ := c.Parse(s) + return t +} + +// Raw returns the raw base language, script and region, without making an +// attempt to infer their values. +func (t Tag) Raw() (b Base, s Script, r Region) { + tt := t.tag() + return Base{tt.LangID}, Script{tt.ScriptID}, Region{tt.RegionID} +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + return compact.Tag(t).IsRoot() +} + +// CanonType can be used to enable or disable various types of canonicalization. +type CanonType int + +const ( + // Replace deprecated base languages with their preferred replacements. + DeprecatedBase CanonType = 1 << iota + // Replace deprecated scripts with their preferred replacements. + DeprecatedScript + // Replace deprecated regions with their preferred replacements. + DeprecatedRegion + // Remove redundant scripts. + SuppressScript + // Normalize legacy encodings. This includes legacy languages defined in + // CLDR as well as bibliographic codes defined in ISO-639. + Legacy + // Map the dominant language of a macro language group to the macro language + // subtag. For example cmn -> zh. + Macro + // The CLDR flag should be used if full compatibility with CLDR is required. + // There are a few cases where language.Tag may differ from CLDR. To follow all + // of CLDR's suggestions, use All|CLDR. + CLDR + + // Raw can be used to Compose or Parse without Canonicalization. + Raw CanonType = 0 + + // Replace all deprecated tags with their preferred replacements. + Deprecated = DeprecatedBase | DeprecatedScript | DeprecatedRegion + + // All canonicalizations recommended by BCP 47. + BCP47 = Deprecated | SuppressScript + + // All canonicalizations. + All = BCP47 | Legacy | Macro + + // Default is the canonicalization used by Parse, Make and Compose. To + // preserve as much information as possible, canonicalizations that remove + // potentially valuable information are not included. The Matcher is + // designed to recognize similar tags that would be the same if + // they were canonicalized using All. + Default = Deprecated | Legacy + + canonLang = DeprecatedBase | Legacy | Macro + + // TODO: LikelyScript, LikelyRegion: suppress similar to ICU. +) + +// canonicalize returns the canonicalized equivalent of the tag and +// whether there was any change. +func canonicalize(c CanonType, t language.Tag) (language.Tag, bool) { + if c == Raw { + return t, false + } + changed := false + if c&SuppressScript != 0 { + if t.LangID.SuppressScript() == t.ScriptID { + t.ScriptID = 0 + changed = true + } + } + if c&canonLang != 0 { + for { + if l, aliasType := t.LangID.Canonicalize(); l != t.LangID { + switch aliasType { + case language.Legacy: + if c&Legacy != 0 { + if t.LangID == _sh && t.ScriptID == 0 { + t.ScriptID = _Latn + } + t.LangID = l + changed = true + } + case language.Macro: + if c&Macro != 0 { + // We deviate here from CLDR. The mapping "nb" -> "no" + // qualifies as a typical Macro language mapping. However, + // for legacy reasons, CLDR maps "no", the macro language + // code for Norwegian, to the dominant variant "nb". This + // change is currently under consideration for CLDR as well. + // See https://unicode.org/cldr/trac/ticket/2698 and also + // https://unicode.org/cldr/trac/ticket/1790 for some of the + // practical implications. TODO: this check could be removed + // if CLDR adopts this change. + if c&CLDR == 0 || t.LangID != _nb { + changed = true + t.LangID = l + } + } + case language.Deprecated: + if c&DeprecatedBase != 0 { + if t.LangID == _mo && t.RegionID == 0 { + t.RegionID = _MD + } + t.LangID = l + changed = true + // Other canonicalization types may still apply. + continue + } + } + } else if c&Legacy != 0 && t.LangID == _no && c&CLDR != 0 { + t.LangID = _nb + changed = true + } + break + } + } + if c&DeprecatedScript != 0 { + if t.ScriptID == _Qaai { + changed = true + t.ScriptID = _Zinh + } + } + if c&DeprecatedRegion != 0 { + if r := t.RegionID.Canonicalize(); r != t.RegionID { + changed = true + t.RegionID = r + } + } + return t, changed +} + +// Canonicalize returns the canonicalized equivalent of the tag. +func (c CanonType) Canonicalize(t Tag) (Tag, error) { + // First try fast path. + if t.isCompact() { + if _, changed := canonicalize(c, compact.Tag(t).Tag()); !changed { + return t, nil + } + } + // It is unlikely that one will canonicalize a tag after matching. So do + // a slow but simple approach here. + if tag, changed := canonicalize(c, t.tag()); changed { + tag.RemakeString() + return makeTag(tag), nil + } + return t, nil + +} + +// Confidence indicates the level of certainty for a given return value. +// For example, Serbian may be written in Cyrillic or Latin script. +// The confidence level indicates whether a value was explicitly specified, +// whether it is typically the only possible value, or whether there is +// an ambiguity. +type Confidence int + +const ( + No Confidence = iota // full confidence that there was no match + Low // most likely value picked out of a set of alternatives + High // value is generally assumed to be the correct match + Exact // exact match or explicitly specified value +) + +var confName = []string{"No", "Low", "High", "Exact"} + +func (c Confidence) String() string { + return confName[c] +} + +// String returns the canonical string representation of the language tag. +func (t Tag) String() string { + return t.tag().String() +} + +// MarshalText implements encoding.TextMarshaler. +func (t Tag) MarshalText() (text []byte, err error) { + return t.tag().MarshalText() +} + +// UnmarshalText implements encoding.TextUnmarshaler. +func (t *Tag) UnmarshalText(text []byte) error { + var tag language.Tag + err := tag.UnmarshalText(text) + *t = makeTag(tag) + return err +} + +// Base returns the base language of the language tag. If the base language is +// unspecified, an attempt will be made to infer it from the context. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Base() (Base, Confidence) { + if b := t.lang(); b != 0 { + return Base{b}, Exact + } + tt := t.tag() + c := High + if tt.ScriptID == 0 && !tt.RegionID.IsCountry() { + c = Low + } + if tag, err := tt.Maximize(); err == nil && tag.LangID != 0 { + return Base{tag.LangID}, c + } + return Base{0}, No +} + +// Script infers the script for the language tag. If it was not explicitly given, it will infer +// a most likely candidate. +// If more than one script is commonly used for a language, the most likely one +// is returned with a low confidence indication. For example, it returns (Cyrl, Low) +// for Serbian. +// If a script cannot be inferred (Zzzz, No) is returned. We do not use Zyyy (undetermined) +// as one would suspect from the IANA registry for BCP 47. In a Unicode context Zyyy marks +// common characters (like 1, 2, 3, '.', etc.) and is therefore more like multiple scripts. +// See https://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for +// unknown value in CLDR. (Zzzz, Exact) is returned if Zzzz was explicitly specified. +// Note that an inferred script is never guaranteed to be the correct one. Latin is +// almost exclusively used for Afrikaans, but Arabic has been used for some texts +// in the past. Also, the script that is commonly used may change over time. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Script() (Script, Confidence) { + if scr := t.script(); scr != 0 { + return Script{scr}, Exact + } + tt := t.tag() + sc, c := language.Script(_Zzzz), No + if scr := tt.LangID.SuppressScript(); scr != 0 { + // Note: it is not always the case that a language with a suppress + // script value is only written in one script (e.g. kk, ms, pa). + if tt.RegionID == 0 { + return Script{scr}, High + } + sc, c = scr, High + } + if tag, err := tt.Maximize(); err == nil { + if tag.ScriptID != sc { + sc, c = tag.ScriptID, Low + } + } else { + tt, _ = canonicalize(Deprecated|Macro, tt) + if tag, err := tt.Maximize(); err == nil && tag.ScriptID != sc { + sc, c = tag.ScriptID, Low + } + } + return Script{sc}, c +} + +// Region returns the region for the language tag. If it was not explicitly given, it will +// infer a most likely candidate from the context. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Region() (Region, Confidence) { + if r := t.region(); r != 0 { + return Region{r}, Exact + } + tt := t.tag() + if tt, err := tt.Maximize(); err == nil { + return Region{tt.RegionID}, Low // TODO: differentiate between high and low. + } + tt, _ = canonicalize(Deprecated|Macro, tt) + if tag, err := tt.Maximize(); err == nil { + return Region{tag.RegionID}, Low + } + return Region{_ZZ}, No // TODO: return world instead of undetermined? +} + +// Variants returns the variants specified explicitly for this language tag. +// or nil if no variant was specified. +func (t Tag) Variants() []Variant { + if !compact.Tag(t).MayHaveVariants() { + return nil + } + v := []Variant{} + x, str := "", t.tag().Variants() + for str != "" { + x, str = nextToken(str) + v = append(v, Variant{x}) + } + return v +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +// +// Parent returns a tag for a less specific language that is mutually +// intelligible or Und if there is no such language. This may not be the same as +// simply stripping the last BCP 47 subtag. For instance, the parent of "zh-TW" +// is "zh-Hant", and the parent of "zh-Hant" is "und". +func (t Tag) Parent() Tag { + return Tag(compact.Tag(t).Parent()) +} + +// nextToken returns token t and the rest of the string. +func nextToken(s string) (t, tail string) { + p := strings.Index(s[1:], "-") + if p == -1 { + return s[1:], "" + } + p++ + return s[1:p], s[p:] +} + +// Extension is a single BCP 47 extension. +type Extension struct { + s string +} + +// String returns the string representation of the extension, including the +// type tag. +func (e Extension) String() string { + return e.s +} + +// ParseExtension parses s as an extension and returns it on success. +func ParseExtension(s string) (e Extension, err error) { + ext, err := language.ParseExtension(s) + return Extension{ext}, err +} + +// Type returns the one-byte extension type of e. It returns 0 for the zero +// exception. +func (e Extension) Type() byte { + if e.s == "" { + return 0 + } + return e.s[0] +} + +// Tokens returns the list of tokens of e. +func (e Extension) Tokens() []string { + return strings.Split(e.s, "-") +} + +// Extension returns the extension of type x for tag t. It will return +// false for ok if t does not have the requested extension. The returned +// extension will be invalid in this case. +func (t Tag) Extension(x byte) (ext Extension, ok bool) { + if !compact.Tag(t).MayHaveExtensions() { + return Extension{}, false + } + e, ok := t.tag().Extension(x) + return Extension{e}, ok +} + +// Extensions returns all extensions of t. +func (t Tag) Extensions() []Extension { + if !compact.Tag(t).MayHaveExtensions() { + return nil + } + e := []Extension{} + for _, ext := range t.tag().Extensions() { + e = append(e, Extension{ext}) + } + return e +} + +// TypeForKey returns the type associated with the given key, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// TypeForKey will traverse the inheritance chain to get the correct value. +// +// If there are multiple types associated with a key, only the first will be +// returned. If there is no type associated with a key, it returns the empty +// string. +func (t Tag) TypeForKey(key string) string { + if !compact.Tag(t).MayHaveExtensions() { + if key != "rg" && key != "va" { + return "" + } + } + return t.tag().TypeForKey(key) +} + +// SetTypeForKey returns a new Tag with the key set to type, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// An empty value removes an existing pair with the same key. +func (t Tag) SetTypeForKey(key, value string) (Tag, error) { + tt, err := t.tag().SetTypeForKey(key, value) + return makeTag(tt), err +} + +// NumCompactTags is the number of compact tags. The maximum tag is +// NumCompactTags-1. +const NumCompactTags = compact.NumCompactTags + +// CompactIndex returns an index, where 0 <= index < NumCompactTags, for tags +// for which data exists in the text repository.The index will change over time +// and should not be stored in persistent storage. If t does not match a compact +// index, exact will be false and the compact index will be returned for the +// first match after repeatedly taking the Parent of t. +func CompactIndex(t Tag) (index int, exact bool) { + id, exact := compact.LanguageID(compact.Tag(t)) + return int(id), exact +} + +var root = language.Tag{} + +// Base is an ISO 639 language code, used for encoding the base language +// of a language tag. +type Base struct { + langID language.Language +} + +// ParseBase parses a 2- or 3-letter ISO 639 code. +// It returns a ValueError if s is a well-formed but unknown language identifier +// or another error if another error occurred. +func ParseBase(s string) (Base, error) { + l, err := language.ParseBase(s) + return Base{l}, err +} + +// String returns the BCP 47 representation of the base language. +func (b Base) String() string { + return b.langID.String() +} + +// ISO3 returns the ISO 639-3 language code. +func (b Base) ISO3() string { + return b.langID.ISO3() +} + +// IsPrivateUse reports whether this language code is reserved for private use. +func (b Base) IsPrivateUse() bool { + return b.langID.IsPrivateUse() +} + +// Script is a 4-letter ISO 15924 code for representing scripts. +// It is idiomatically represented in title case. +type Script struct { + scriptID language.Script +} + +// ParseScript parses a 4-letter ISO 15924 code. +// It returns a ValueError if s is a well-formed but unknown script identifier +// or another error if another error occurred. +func ParseScript(s string) (Script, error) { + sc, err := language.ParseScript(s) + return Script{sc}, err +} + +// String returns the script code in title case. +// It returns "Zzzz" for an unspecified script. +func (s Script) String() string { + return s.scriptID.String() +} + +// IsPrivateUse reports whether this script code is reserved for private use. +func (s Script) IsPrivateUse() bool { + return s.scriptID.IsPrivateUse() +} + +// Region is an ISO 3166-1 or UN M.49 code for representing countries and regions. +type Region struct { + regionID language.Region +} + +// EncodeM49 returns the Region for the given UN M.49 code. +// It returns an error if r is not a valid code. +func EncodeM49(r int) (Region, error) { + rid, err := language.EncodeM49(r) + return Region{rid}, err +} + +// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. +// It returns a ValueError if s is a well-formed but unknown region identifier +// or another error if another error occurred. +func ParseRegion(s string) (Region, error) { + r, err := language.ParseRegion(s) + return Region{r}, err +} + +// String returns the BCP 47 representation for the region. +// It returns "ZZ" for an unspecified region. +func (r Region) String() string { + return r.regionID.String() +} + +// ISO3 returns the 3-letter ISO code of r. +// Note that not all regions have a 3-letter ISO code. +// In such cases this method returns "ZZZ". +func (r Region) ISO3() string { + return r.regionID.ISO3() +} + +// M49 returns the UN M.49 encoding of r, or 0 if this encoding +// is not defined for r. +func (r Region) M49() int { + return r.regionID.M49() +} + +// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This +// may include private-use tags that are assigned by CLDR and used in this +// implementation. So IsPrivateUse and IsCountry can be simultaneously true. +func (r Region) IsPrivateUse() bool { + return r.regionID.IsPrivateUse() +} + +// IsCountry returns whether this region is a country or autonomous area. This +// includes non-standard definitions from CLDR. +func (r Region) IsCountry() bool { + return r.regionID.IsCountry() +} + +// IsGroup returns whether this region defines a collection of regions. This +// includes non-standard definitions from CLDR. +func (r Region) IsGroup() bool { + return r.regionID.IsGroup() +} + +// Contains returns whether Region c is contained by Region r. It returns true +// if c == r. +func (r Region) Contains(c Region) bool { + return r.regionID.Contains(c.regionID) +} + +// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. +// In all other cases it returns either the region itself or an error. +// +// This method may return an error for a region for which there exists a +// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The +// region will already be canonicalized it was obtained from a Tag that was +// obtained using any of the default methods. +func (r Region) TLD() (Region, error) { + tld, err := r.regionID.TLD() + return Region{tld}, err +} + +// Canonicalize returns the region or a possible replacement if the region is +// deprecated. It will not return a replacement for deprecated regions that +// are split into multiple regions. +func (r Region) Canonicalize() Region { + return Region{r.regionID.Canonicalize()} +} + +// Variant represents a registered variant of a language as defined by BCP 47. +type Variant struct { + variant string +} + +// ParseVariant parses and returns a Variant. An error is returned if s is not +// a valid variant. +func ParseVariant(s string) (Variant, error) { + v, err := language.ParseVariant(s) + return Variant{v.String()}, err +} + +// String returns the string representation of the variant. +func (v Variant) String() string { + return v.variant +} diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go new file mode 100644 index 0000000..1153baf --- /dev/null +++ b/vendor/golang.org/x/text/language/match.go @@ -0,0 +1,735 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "errors" + "strings" + + "golang.org/x/text/internal/language" +) + +// A MatchOption configures a Matcher. +type MatchOption func(*matcher) + +// PreferSameScript will, in the absence of a match, result in the first +// preferred tag with the same script as a supported tag to match this supported +// tag. The default is currently true, but this may change in the future. +func PreferSameScript(preferSame bool) MatchOption { + return func(m *matcher) { m.preferSameScript = preferSame } +} + +// TODO(v1.0.0): consider making Matcher a concrete type, instead of interface. +// There doesn't seem to be too much need for multiple types. +// Making it a concrete type allows MatchStrings to be a method, which will +// improve its discoverability. + +// MatchStrings parses and matches the given strings until one of them matches +// the language in the Matcher. A string may be an Accept-Language header as +// handled by ParseAcceptLanguage. The default language is returned if no +// other language matched. +func MatchStrings(m Matcher, lang ...string) (tag Tag, index int) { + for _, accept := range lang { + desired, _, err := ParseAcceptLanguage(accept) + if err != nil { + continue + } + if tag, index, conf := m.Match(desired...); conf != No { + return tag, index + } + } + tag, index, _ = m.Match() + return +} + +// Matcher is the interface that wraps the Match method. +// +// Match returns the best match for any of the given tags, along with +// a unique index associated with the returned tag and a confidence +// score. +type Matcher interface { + Match(t ...Tag) (tag Tag, index int, c Confidence) +} + +// Comprehends reports the confidence score for a speaker of a given language +// to being able to comprehend the written form of an alternative language. +func Comprehends(speaker, alternative Tag) Confidence { + _, _, c := NewMatcher([]Tag{alternative}).Match(speaker) + return c +} + +// NewMatcher returns a Matcher that matches an ordered list of preferred tags +// against a list of supported tags based on written intelligibility, closeness +// of dialect, equivalence of subtags and various other rules. It is initialized +// with the list of supported tags. The first element is used as the default +// value in case no match is found. +// +// Its Match method matches the first of the given Tags to reach a certain +// confidence threshold. The tags passed to Match should therefore be specified +// in order of preference. Extensions are ignored for matching. +// +// The index returned by the Match method corresponds to the index of the +// matched tag in t, but is augmented with the Unicode extension ('u')of the +// corresponding preferred tag. This allows user locale options to be passed +// transparently. +func NewMatcher(t []Tag, options ...MatchOption) Matcher { + return newMatcher(t, options) +} + +func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) { + var tt language.Tag + match, w, c := m.getBest(want...) + if match != nil { + tt, index = match.tag, match.index + } else { + // TODO: this should be an option + tt = m.default_.tag + if m.preferSameScript { + outer: + for _, w := range want { + script, _ := w.Script() + if script.scriptID == 0 { + // Don't do anything if there is no script, such as with + // private subtags. + continue + } + for i, h := range m.supported { + if script.scriptID == h.maxScript { + tt, index = h.tag, i + break outer + } + } + } + } + // TODO: select first language tag based on script. + } + if w.RegionID != tt.RegionID && w.RegionID != 0 { + if w.RegionID != 0 && tt.RegionID != 0 && tt.RegionID.Contains(w.RegionID) { + tt.RegionID = w.RegionID + tt.RemakeString() + } else if r := w.RegionID.String(); len(r) == 2 { + // TODO: also filter macro and deprecated. + tt, _ = tt.SetTypeForKey("rg", strings.ToLower(r)+"zzzz") + } + } + // Copy options from the user-provided tag into the result tag. This is hard + // to do after the fact, so we do it here. + // TODO: add in alternative variants to -u-va-. + // TODO: add preferred region to -u-rg-. + if e := w.Extensions(); len(e) > 0 { + b := language.Builder{} + b.SetTag(tt) + for _, e := range e { + b.AddExt(e) + } + tt = b.Make() + } + return makeTag(tt), index, c +} + +// ErrMissingLikelyTagsData indicates no information was available +// to compute likely values of missing tags. +var ErrMissingLikelyTagsData = errors.New("missing likely tags data") + +// func (t *Tag) setTagsFrom(id Tag) { +// t.LangID = id.LangID +// t.ScriptID = id.ScriptID +// t.RegionID = id.RegionID +// } + +// Tag Matching +// CLDR defines an algorithm for finding the best match between two sets of language +// tags. The basic algorithm defines how to score a possible match and then find +// the match with the best score +// (see https://www.unicode.org/reports/tr35/#LanguageMatching). +// Using scoring has several disadvantages. The scoring obfuscates the importance of +// the various factors considered, making the algorithm harder to understand. Using +// scoring also requires the full score to be computed for each pair of tags. +// +// We will use a different algorithm which aims to have the following properties: +// - clarity on the precedence of the various selection factors, and +// - improved performance by allowing early termination of a comparison. +// +// Matching algorithm (overview) +// Input: +// - supported: a set of supported tags +// - default: the default tag to return in case there is no match +// - desired: list of desired tags, ordered by preference, starting with +// the most-preferred. +// +// Algorithm: +// 1) Set the best match to the lowest confidence level +// 2) For each tag in "desired": +// a) For each tag in "supported": +// 1) compute the match between the two tags. +// 2) if the match is better than the previous best match, replace it +// with the new match. (see next section) +// b) if the current best match is Exact and pin is true the result will be +// frozen to the language found thusfar, although better matches may +// still be found for the same language. +// 3) If the best match so far is below a certain threshold, return "default". +// +// Ranking: +// We use two phases to determine whether one pair of tags are a better match +// than another pair of tags. First, we determine a rough confidence level. If the +// levels are different, the one with the highest confidence wins. +// Second, if the rough confidence levels are identical, we use a set of tie-breaker +// rules. +// +// The confidence level of matching a pair of tags is determined by finding the +// lowest confidence level of any matches of the corresponding subtags (the +// result is deemed as good as its weakest link). +// We define the following levels: +// Exact - An exact match of a subtag, before adding likely subtags. +// MaxExact - An exact match of a subtag, after adding likely subtags. +// [See Note 2]. +// High - High level of mutual intelligibility between different subtag +// variants. +// Low - Low level of mutual intelligibility between different subtag +// variants. +// No - No mutual intelligibility. +// +// The following levels can occur for each type of subtag: +// Base: Exact, MaxExact, High, Low, No +// Script: Exact, MaxExact [see Note 3], Low, No +// Region: Exact, MaxExact, High +// Variant: Exact, High +// Private: Exact, No +// +// Any result with a confidence level of Low or higher is deemed a possible match. +// Once a desired tag matches any of the supported tags with a level of MaxExact +// or higher, the next desired tag is not considered (see Step 2.b). +// Note that CLDR provides languageMatching data that defines close equivalence +// classes for base languages, scripts and regions. +// +// Tie-breaking +// If we get the same confidence level for two matches, we apply a sequence of +// tie-breaking rules. The first that succeeds defines the result. The rules are +// applied in the following order. +// 1) Original language was defined and was identical. +// 2) Original region was defined and was identical. +// 3) Distance between two maximized regions was the smallest. +// 4) Original script was defined and was identical. +// 5) Distance from want tag to have tag using the parent relation [see Note 5.] +// If there is still no winner after these rules are applied, the first match +// found wins. +// +// Notes: +// [2] In practice, as matching of Exact is done in a separate phase from +// matching the other levels, we reuse the Exact level to mean MaxExact in +// the second phase. As a consequence, we only need the levels defined by +// the Confidence type. The MaxExact confidence level is mapped to High in +// the public API. +// [3] We do not differentiate between maximized script values that were derived +// from suppressScript versus most likely tag data. We determined that in +// ranking the two, one ranks just after the other. Moreover, the two cannot +// occur concurrently. As a consequence, they are identical for practical +// purposes. +// [4] In case of deprecated, macro-equivalents and legacy mappings, we assign +// the MaxExact level to allow iw vs he to still be a closer match than +// en-AU vs en-US, for example. +// [5] In CLDR a locale inherits fields that are unspecified for this locale +// from its parent. Therefore, if a locale is a parent of another locale, +// it is a strong measure for closeness, especially when no other tie +// breaker rule applies. One could also argue it is inconsistent, for +// example, when pt-AO matches pt (which CLDR equates with pt-BR), even +// though its parent is pt-PT according to the inheritance rules. +// +// Implementation Details: +// There are several performance considerations worth pointing out. Most notably, +// we preprocess as much as possible (within reason) at the time of creation of a +// matcher. This includes: +// - creating a per-language map, which includes data for the raw base language +// and its canonicalized variant (if applicable), +// - expanding entries for the equivalence classes defined in CLDR's +// languageMatch data. +// The per-language map ensures that typically only a very small number of tags +// need to be considered. The pre-expansion of canonicalized subtags and +// equivalence classes reduces the amount of map lookups that need to be done at +// runtime. + +// matcher keeps a set of supported language tags, indexed by language. +type matcher struct { + default_ *haveTag + supported []*haveTag + index map[language.Language]*matchHeader + passSettings bool + preferSameScript bool +} + +// matchHeader has the lists of tags for exact matches and matches based on +// maximized and canonicalized tags for a given language. +type matchHeader struct { + haveTags []*haveTag + original bool +} + +// haveTag holds a supported Tag and its maximized script and region. The maximized +// or canonicalized language is not stored as it is not needed during matching. +type haveTag struct { + tag language.Tag + + // index of this tag in the original list of supported tags. + index int + + // conf is the maximum confidence that can result from matching this haveTag. + // When conf < Exact this means it was inserted after applying a CLDR equivalence rule. + conf Confidence + + // Maximized region and script. + maxRegion language.Region + maxScript language.Script + + // altScript may be checked as an alternative match to maxScript. If altScript + // matches, the confidence level for this match is Low. Theoretically there + // could be multiple alternative scripts. This does not occur in practice. + altScript language.Script + + // nextMax is the index of the next haveTag with the same maximized tags. + nextMax uint16 +} + +func makeHaveTag(tag language.Tag, index int) (haveTag, language.Language) { + max := tag + if tag.LangID != 0 || tag.RegionID != 0 || tag.ScriptID != 0 { + max, _ = canonicalize(All, max) + max, _ = max.Maximize() + max.RemakeString() + } + return haveTag{tag, index, Exact, max.RegionID, max.ScriptID, altScript(max.LangID, max.ScriptID), 0}, max.LangID +} + +// altScript returns an alternative script that may match the given script with +// a low confidence. At the moment, the langMatch data allows for at most one +// script to map to another and we rely on this to keep the code simple. +func altScript(l language.Language, s language.Script) language.Script { + for _, alt := range matchScript { + // TODO: also match cases where language is not the same. + if (language.Language(alt.wantLang) == l || language.Language(alt.haveLang) == l) && + language.Script(alt.haveScript) == s { + return language.Script(alt.wantScript) + } + } + return 0 +} + +// addIfNew adds a haveTag to the list of tags only if it is a unique tag. +// Tags that have the same maximized values are linked by index. +func (h *matchHeader) addIfNew(n haveTag, exact bool) { + h.original = h.original || exact + // Don't add new exact matches. + for _, v := range h.haveTags { + if equalsRest(v.tag, n.tag) { + return + } + } + // Allow duplicate maximized tags, but create a linked list to allow quickly + // comparing the equivalents and bail out. + for i, v := range h.haveTags { + if v.maxScript == n.maxScript && + v.maxRegion == n.maxRegion && + v.tag.VariantOrPrivateUseTags() == n.tag.VariantOrPrivateUseTags() { + for h.haveTags[i].nextMax != 0 { + i = int(h.haveTags[i].nextMax) + } + h.haveTags[i].nextMax = uint16(len(h.haveTags)) + break + } + } + h.haveTags = append(h.haveTags, &n) +} + +// header returns the matchHeader for the given language. It creates one if +// it doesn't already exist. +func (m *matcher) header(l language.Language) *matchHeader { + if h := m.index[l]; h != nil { + return h + } + h := &matchHeader{} + m.index[l] = h + return h +} + +func toConf(d uint8) Confidence { + if d <= 10 { + return High + } + if d < 30 { + return Low + } + return No +} + +// newMatcher builds an index for the given supported tags and returns it as +// a matcher. It also expands the index by considering various equivalence classes +// for a given tag. +func newMatcher(supported []Tag, options []MatchOption) *matcher { + m := &matcher{ + index: make(map[language.Language]*matchHeader), + preferSameScript: true, + } + for _, o := range options { + o(m) + } + if len(supported) == 0 { + m.default_ = &haveTag{} + return m + } + // Add supported languages to the index. Add exact matches first to give + // them precedence. + for i, tag := range supported { + tt := tag.tag() + pair, _ := makeHaveTag(tt, i) + m.header(tt.LangID).addIfNew(pair, true) + m.supported = append(m.supported, &pair) + } + m.default_ = m.header(supported[0].lang()).haveTags[0] + // Keep these in two different loops to support the case that two equivalent + // languages are distinguished, such as iw and he. + for i, tag := range supported { + tt := tag.tag() + pair, max := makeHaveTag(tt, i) + if max != tt.LangID { + m.header(max).addIfNew(pair, true) + } + } + + // update is used to add indexes in the map for equivalent languages. + // update will only add entries to original indexes, thus not computing any + // transitive relations. + update := func(want, have uint16, conf Confidence) { + if hh := m.index[language.Language(have)]; hh != nil { + if !hh.original { + return + } + hw := m.header(language.Language(want)) + for _, ht := range hh.haveTags { + v := *ht + if conf < v.conf { + v.conf = conf + } + v.nextMax = 0 // this value needs to be recomputed + if v.altScript != 0 { + v.altScript = altScript(language.Language(want), v.maxScript) + } + hw.addIfNew(v, conf == Exact && hh.original) + } + } + } + + // Add entries for languages with mutual intelligibility as defined by CLDR's + // languageMatch data. + for _, ml := range matchLang { + update(ml.want, ml.have, toConf(ml.distance)) + if !ml.oneway { + update(ml.have, ml.want, toConf(ml.distance)) + } + } + + // Add entries for possible canonicalizations. This is an optimization to + // ensure that only one map lookup needs to be done at runtime per desired tag. + // First we match deprecated equivalents. If they are perfect equivalents + // (their canonicalization simply substitutes a different language code, but + // nothing else), the match confidence is Exact, otherwise it is High. + for i, lm := range language.AliasMap { + // If deprecated codes match and there is no fiddling with the script + // or region, we consider it an exact match. + conf := Exact + if language.AliasTypes[i] != language.Macro { + if !isExactEquivalent(language.Language(lm.From)) { + conf = High + } + update(lm.To, lm.From, conf) + } + update(lm.From, lm.To, conf) + } + return m +} + +// getBest gets the best matching tag in m for any of the given tags, taking into +// account the order of preference of the given tags. +func (m *matcher) getBest(want ...Tag) (got *haveTag, orig language.Tag, c Confidence) { + best := bestMatch{} + for i, ww := range want { + w := ww.tag() + var max language.Tag + // Check for exact match first. + h := m.index[w.LangID] + if w.LangID != 0 { + if h == nil { + continue + } + // Base language is defined. + max, _ = canonicalize(Legacy|Deprecated|Macro, w) + // A region that is added through canonicalization is stronger than + // a maximized region: set it in the original (e.g. mo -> ro-MD). + if w.RegionID != max.RegionID { + w.RegionID = max.RegionID + } + // TODO: should we do the same for scripts? + // See test case: en, sr, nl ; sh ; sr + max, _ = max.Maximize() + } else { + // Base language is not defined. + if h != nil { + for i := range h.haveTags { + have := h.haveTags[i] + if equalsRest(have.tag, w) { + return have, w, Exact + } + } + } + if w.ScriptID == 0 && w.RegionID == 0 { + // We skip all tags matching und for approximate matching, including + // private tags. + continue + } + max, _ = w.Maximize() + if h = m.index[max.LangID]; h == nil { + continue + } + } + pin := true + for _, t := range want[i+1:] { + if w.LangID == t.lang() { + pin = false + break + } + } + // Check for match based on maximized tag. + for i := range h.haveTags { + have := h.haveTags[i] + best.update(have, w, max.ScriptID, max.RegionID, pin) + if best.conf == Exact { + for have.nextMax != 0 { + have = h.haveTags[have.nextMax] + best.update(have, w, max.ScriptID, max.RegionID, pin) + } + return best.have, best.want, best.conf + } + } + } + if best.conf <= No { + if len(want) != 0 { + return nil, want[0].tag(), No + } + return nil, language.Tag{}, No + } + return best.have, best.want, best.conf +} + +// bestMatch accumulates the best match so far. +type bestMatch struct { + have *haveTag + want language.Tag + conf Confidence + pinnedRegion language.Region + pinLanguage bool + sameRegionGroup bool + // Cached results from applying tie-breaking rules. + origLang bool + origReg bool + paradigmReg bool + regGroupDist uint8 + origScript bool +} + +// update updates the existing best match if the new pair is considered to be a +// better match. To determine if the given pair is a better match, it first +// computes the rough confidence level. If this surpasses the current match, it +// will replace it and update the tie-breaker rule cache. If there is a tie, it +// proceeds with applying a series of tie-breaker rules. If there is no +// conclusive winner after applying the tie-breaker rules, it leaves the current +// match as the preferred match. +// +// If pin is true and have and tag are a strong match, it will henceforth only +// consider matches for this language. This corresponds to the idea that most +// users have a strong preference for the first defined language. A user can +// still prefer a second language over a dialect of the preferred language by +// explicitly specifying dialects, e.g. "en, nl, en-GB". In this case pin should +// be false. +func (m *bestMatch) update(have *haveTag, tag language.Tag, maxScript language.Script, maxRegion language.Region, pin bool) { + // Bail if the maximum attainable confidence is below that of the current best match. + c := have.conf + if c < m.conf { + return + } + // Don't change the language once we already have found an exact match. + if m.pinLanguage && tag.LangID != m.want.LangID { + return + } + // Pin the region group if we are comparing tags for the same language. + if tag.LangID == m.want.LangID && m.sameRegionGroup { + _, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.LangID) + if !sameGroup { + return + } + } + if c == Exact && have.maxScript == maxScript { + // If there is another language and then another entry of this language, + // don't pin anything, otherwise pin the language. + m.pinLanguage = pin + } + if equalsRest(have.tag, tag) { + } else if have.maxScript != maxScript { + // There is usually very little comprehension between different scripts. + // In a few cases there may still be Low comprehension. This possibility + // is pre-computed and stored in have.altScript. + if Low < m.conf || have.altScript != maxScript { + return + } + c = Low + } else if have.maxRegion != maxRegion { + if High < c { + // There is usually a small difference between languages across regions. + c = High + } + } + + // We store the results of the computations of the tie-breaker rules along + // with the best match. There is no need to do the checks once we determine + // we have a winner, but we do still need to do the tie-breaker computations. + // We use "beaten" to keep track if we still need to do the checks. + beaten := false // true if the new pair defeats the current one. + if c != m.conf { + if c < m.conf { + return + } + beaten = true + } + + // Tie-breaker rules: + // We prefer if the pre-maximized language was specified and identical. + origLang := have.tag.LangID == tag.LangID && tag.LangID != 0 + if !beaten && m.origLang != origLang { + if m.origLang { + return + } + beaten = true + } + + // We prefer if the pre-maximized region was specified and identical. + origReg := have.tag.RegionID == tag.RegionID && tag.RegionID != 0 + if !beaten && m.origReg != origReg { + if m.origReg { + return + } + beaten = true + } + + regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.LangID) + if !beaten && m.regGroupDist != regGroupDist { + if regGroupDist > m.regGroupDist { + return + } + beaten = true + } + + paradigmReg := isParadigmLocale(tag.LangID, have.maxRegion) + if !beaten && m.paradigmReg != paradigmReg { + if !paradigmReg { + return + } + beaten = true + } + + // Next we prefer if the pre-maximized script was specified and identical. + origScript := have.tag.ScriptID == tag.ScriptID && tag.ScriptID != 0 + if !beaten && m.origScript != origScript { + if m.origScript { + return + } + beaten = true + } + + // Update m to the newly found best match. + if beaten { + m.have = have + m.want = tag + m.conf = c + m.pinnedRegion = maxRegion + m.sameRegionGroup = sameGroup + m.origLang = origLang + m.origReg = origReg + m.paradigmReg = paradigmReg + m.origScript = origScript + m.regGroupDist = regGroupDist + } +} + +func isParadigmLocale(lang language.Language, r language.Region) bool { + for _, e := range paradigmLocales { + if language.Language(e[0]) == lang && (r == language.Region(e[1]) || r == language.Region(e[2])) { + return true + } + } + return false +} + +// regionGroupDist computes the distance between two regions based on their +// CLDR grouping. +func regionGroupDist(a, b language.Region, script language.Script, lang language.Language) (dist uint8, same bool) { + const defaultDistance = 4 + + aGroup := uint(regionToGroups[a]) << 1 + bGroup := uint(regionToGroups[b]) << 1 + for _, ri := range matchRegion { + if language.Language(ri.lang) == lang && (ri.script == 0 || language.Script(ri.script) == script) { + group := uint(1 << (ri.group &^ 0x80)) + if 0x80&ri.group == 0 { + if aGroup&bGroup&group != 0 { // Both regions are in the group. + return ri.distance, ri.distance == defaultDistance + } + } else { + if (aGroup|bGroup)&group == 0 { // Both regions are not in the group. + return ri.distance, ri.distance == defaultDistance + } + } + } + } + return defaultDistance, true +} + +// equalsRest compares everything except the language. +func equalsRest(a, b language.Tag) bool { + // TODO: don't include extensions in this comparison. To do this efficiently, + // though, we should handle private tags separately. + return a.ScriptID == b.ScriptID && a.RegionID == b.RegionID && a.VariantOrPrivateUseTags() == b.VariantOrPrivateUseTags() +} + +// isExactEquivalent returns true if canonicalizing the language will not alter +// the script or region of a tag. +func isExactEquivalent(l language.Language) bool { + for _, o := range notEquivalent { + if o == l { + return false + } + } + return true +} + +var notEquivalent []language.Language + +func init() { + // Create a list of all languages for which canonicalization may alter the + // script or region. + for _, lm := range language.AliasMap { + tag := language.Tag{LangID: language.Language(lm.From)} + if tag, _ = canonicalize(All, tag); tag.ScriptID != 0 || tag.RegionID != 0 { + notEquivalent = append(notEquivalent, language.Language(lm.From)) + } + } + // Maximize undefined regions of paradigm locales. + for i, v := range paradigmLocales { + t := language.Tag{LangID: language.Language(v[0])} + max, _ := t.Maximize() + if v[1] == 0 { + paradigmLocales[i][1] = uint16(max.RegionID) + } + if v[2] == 0 { + paradigmLocales[i][2] = uint16(max.RegionID) + } + } +} diff --git a/vendor/golang.org/x/text/language/parse.go b/vendor/golang.org/x/text/language/parse.go new file mode 100644 index 0000000..053336e --- /dev/null +++ b/vendor/golang.org/x/text/language/parse.go @@ -0,0 +1,256 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "errors" + "sort" + "strconv" + "strings" + + "golang.org/x/text/internal/language" +) + +// ValueError is returned by any of the parsing functions when the +// input is well-formed but the respective subtag is not recognized +// as a valid value. +type ValueError interface { + error + + // Subtag returns the subtag for which the error occurred. + Subtag() string +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// The resulting tag is canonicalized using the default canonicalization type. +func Parse(s string) (t Tag, err error) { + return Default.Parse(s) +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// The resulting tag is canonicalized using the canonicalization type c. +func (c CanonType) Parse(s string) (t Tag, err error) { + defer func() { + if recover() != nil { + t = Tag{} + err = language.ErrSyntax + } + }() + + tt, err := language.Parse(s) + if err != nil { + return makeTag(tt), err + } + tt, changed := canonicalize(c, tt) + if changed { + tt.RemakeString() + } + return makeTag(tt), nil +} + +// Compose creates a Tag from individual parts, which may be of type Tag, Base, +// Script, Region, Variant, []Variant, Extension, []Extension or error. If a +// Base, Script or Region or slice of type Variant or Extension is passed more +// than once, the latter will overwrite the former. Variants and Extensions are +// accumulated, but if two extensions of the same type are passed, the latter +// will replace the former. For -u extensions, though, the key-type pairs are +// added, where later values overwrite older ones. A Tag overwrites all former +// values and typically only makes sense as the first argument. The resulting +// tag is returned after canonicalizing using the Default CanonType. If one or +// more errors are encountered, one of the errors is returned. +func Compose(part ...interface{}) (t Tag, err error) { + return Default.Compose(part...) +} + +// Compose creates a Tag from individual parts, which may be of type Tag, Base, +// Script, Region, Variant, []Variant, Extension, []Extension or error. If a +// Base, Script or Region or slice of type Variant or Extension is passed more +// than once, the latter will overwrite the former. Variants and Extensions are +// accumulated, but if two extensions of the same type are passed, the latter +// will replace the former. For -u extensions, though, the key-type pairs are +// added, where later values overwrite older ones. A Tag overwrites all former +// values and typically only makes sense as the first argument. The resulting +// tag is returned after canonicalizing using CanonType c. If one or more errors +// are encountered, one of the errors is returned. +func (c CanonType) Compose(part ...interface{}) (t Tag, err error) { + defer func() { + if recover() != nil { + t = Tag{} + err = language.ErrSyntax + } + }() + + var b language.Builder + if err = update(&b, part...); err != nil { + return und, err + } + b.Tag, _ = canonicalize(c, b.Tag) + return makeTag(b.Make()), err +} + +var errInvalidArgument = errors.New("invalid Extension or Variant") + +func update(b *language.Builder, part ...interface{}) (err error) { + for _, x := range part { + switch v := x.(type) { + case Tag: + b.SetTag(v.tag()) + case Base: + b.Tag.LangID = v.langID + case Script: + b.Tag.ScriptID = v.scriptID + case Region: + b.Tag.RegionID = v.regionID + case Variant: + if v.variant == "" { + err = errInvalidArgument + break + } + b.AddVariant(v.variant) + case Extension: + if v.s == "" { + err = errInvalidArgument + break + } + b.SetExt(v.s) + case []Variant: + b.ClearVariants() + for _, v := range v { + b.AddVariant(v.variant) + } + case []Extension: + b.ClearExtensions() + for _, e := range v { + b.SetExt(e.s) + } + // TODO: support parsing of raw strings based on morphology or just extensions? + case error: + if v != nil { + err = v + } + } + } + return +} + +var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight") +var errTagListTooLarge = errors.New("tag list exceeds max length") + +// ParseAcceptLanguage parses the contents of an Accept-Language header as +// defined in http://www.ietf.org/rfc/rfc2616.txt and returns a list of Tags and +// a list of corresponding quality weights. It is more permissive than RFC 2616 +// and may return non-nil slices even if the input is not valid. +// The Tags will be sorted by highest weight first and then by first occurrence. +// Tags with a weight of zero will be dropped. An error will be returned if the +// input could not be parsed. +func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) { + defer func() { + if recover() != nil { + tag = nil + q = nil + err = language.ErrSyntax + } + }() + + if strings.Count(s, "-") > 1000 { + return nil, nil, errTagListTooLarge + } + + var entry string + for s != "" { + if entry, s = split(s, ','); entry == "" { + continue + } + + entry, weight := split(entry, ';') + + // Scan the language. + t, err := Parse(entry) + if err != nil { + id, ok := acceptFallback[entry] + if !ok { + return nil, nil, err + } + t = makeTag(language.Tag{LangID: id}) + } + + // Scan the optional weight. + w := 1.0 + if weight != "" { + weight = consume(weight, 'q') + weight = consume(weight, '=') + // consume returns the empty string when a token could not be + // consumed, resulting in an error for ParseFloat. + if w, err = strconv.ParseFloat(weight, 32); err != nil { + return nil, nil, errInvalidWeight + } + // Drop tags with a quality weight of 0. + if w <= 0 { + continue + } + } + + tag = append(tag, t) + q = append(q, float32(w)) + } + sort.Stable(&tagSort{tag, q}) + return tag, q, nil +} + +// consume removes a leading token c from s and returns the result or the empty +// string if there is no such token. +func consume(s string, c byte) string { + if s == "" || s[0] != c { + return "" + } + return strings.TrimSpace(s[1:]) +} + +func split(s string, c byte) (head, tail string) { + if i := strings.IndexByte(s, c); i >= 0 { + return strings.TrimSpace(s[:i]), strings.TrimSpace(s[i+1:]) + } + return strings.TrimSpace(s), "" +} + +// Add hack mapping to deal with a small number of cases that occur +// in Accept-Language (with reasonable frequency). +var acceptFallback = map[string]language.Language{ + "english": _en, + "deutsch": _de, + "italian": _it, + "french": _fr, + "*": _mul, // defined in the spec to match all languages. +} + +type tagSort struct { + tag []Tag + q []float32 +} + +func (s *tagSort) Len() int { + return len(s.q) +} + +func (s *tagSort) Less(i, j int) bool { + return s.q[i] > s.q[j] +} + +func (s *tagSort) Swap(i, j int) { + s.tag[i], s.tag[j] = s.tag[j], s.tag[i] + s.q[i], s.q[j] = s.q[j], s.q[i] +} diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go new file mode 100644 index 0000000..a6573dc --- /dev/null +++ b/vendor/golang.org/x/text/language/tables.go @@ -0,0 +1,298 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +const ( + _de = 269 + _en = 313 + _fr = 350 + _it = 505 + _mo = 784 + _no = 879 + _nb = 839 + _pt = 960 + _sh = 1031 + _mul = 806 + _und = 0 +) +const ( + _001 = 1 + _419 = 31 + _BR = 65 + _CA = 73 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 +) +const ( + _Latn = 91 + _Hani = 57 + _Hans = 59 + _Hant = 60 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 +) + +var regionToGroups = []uint8{ // 359 elements + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x01, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x04, + // Entry 40 - 7F + 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x08, 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, + // Entry 80 - BF + 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, + 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, + // Entry C0 - FF + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, + 0x01, 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 100 - 13F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, + // Entry 140 - 17F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, +} // Size: 383 bytes + +var paradigmLocales = [][3]uint16{ // 3 elements + 0: [3]uint16{0x139, 0x0, 0x7c}, + 1: [3]uint16{0x13e, 0x0, 0x1f}, + 2: [3]uint16{0x3c0, 0x41, 0xef}, +} // Size: 42 bytes + +type mutualIntelligibility struct { + want uint16 + have uint16 + distance uint8 + oneway bool +} +type scriptIntelligibility struct { + wantLang uint16 + haveLang uint16 + wantScript uint8 + haveScript uint8 + distance uint8 +} +type regionIntelligibility struct { + lang uint16 + script uint8 + group uint8 + distance uint8 +} + +// matchLang holds pairs of langIDs of base languages that are typically +// mutually intelligible. Each pair is associated with a confidence and +// whether the intelligibility goes one or both ways. +var matchLang = []mutualIntelligibility{ // 113 elements + 0: {want: 0x1d1, have: 0xb7, distance: 0x4, oneway: false}, + 1: {want: 0x407, have: 0xb7, distance: 0x4, oneway: false}, + 2: {want: 0x407, have: 0x1d1, distance: 0x4, oneway: false}, + 3: {want: 0x407, have: 0x432, distance: 0x4, oneway: false}, + 4: {want: 0x43a, have: 0x1, distance: 0x4, oneway: false}, + 5: {want: 0x1a3, have: 0x10d, distance: 0x4, oneway: true}, + 6: {want: 0x295, have: 0x10d, distance: 0x4, oneway: true}, + 7: {want: 0x101, have: 0x36f, distance: 0x8, oneway: false}, + 8: {want: 0x101, have: 0x347, distance: 0x8, oneway: false}, + 9: {want: 0x5, have: 0x3e2, distance: 0xa, oneway: true}, + 10: {want: 0xd, have: 0x139, distance: 0xa, oneway: true}, + 11: {want: 0x16, have: 0x367, distance: 0xa, oneway: true}, + 12: {want: 0x21, have: 0x139, distance: 0xa, oneway: true}, + 13: {want: 0x56, have: 0x13e, distance: 0xa, oneway: true}, + 14: {want: 0x58, have: 0x3e2, distance: 0xa, oneway: true}, + 15: {want: 0x71, have: 0x3e2, distance: 0xa, oneway: true}, + 16: {want: 0x75, have: 0x139, distance: 0xa, oneway: true}, + 17: {want: 0x82, have: 0x1be, distance: 0xa, oneway: true}, + 18: {want: 0xa5, have: 0x139, distance: 0xa, oneway: true}, + 19: {want: 0xb2, have: 0x15e, distance: 0xa, oneway: true}, + 20: {want: 0xdd, have: 0x153, distance: 0xa, oneway: true}, + 21: {want: 0xe5, have: 0x139, distance: 0xa, oneway: true}, + 22: {want: 0xe9, have: 0x3a, distance: 0xa, oneway: true}, + 23: {want: 0xf0, have: 0x15e, distance: 0xa, oneway: true}, + 24: {want: 0xf9, have: 0x15e, distance: 0xa, oneway: true}, + 25: {want: 0x100, have: 0x139, distance: 0xa, oneway: true}, + 26: {want: 0x130, have: 0x139, distance: 0xa, oneway: true}, + 27: {want: 0x13c, have: 0x139, distance: 0xa, oneway: true}, + 28: {want: 0x140, have: 0x151, distance: 0xa, oneway: true}, + 29: {want: 0x145, have: 0x13e, distance: 0xa, oneway: true}, + 30: {want: 0x158, have: 0x101, distance: 0xa, oneway: true}, + 31: {want: 0x16d, have: 0x367, distance: 0xa, oneway: true}, + 32: {want: 0x16e, have: 0x139, distance: 0xa, oneway: true}, + 33: {want: 0x16f, have: 0x139, distance: 0xa, oneway: true}, + 34: {want: 0x17e, have: 0x139, distance: 0xa, oneway: true}, + 35: {want: 0x190, have: 0x13e, distance: 0xa, oneway: true}, + 36: {want: 0x194, have: 0x13e, distance: 0xa, oneway: true}, + 37: {want: 0x1a4, have: 0x1be, distance: 0xa, oneway: true}, + 38: {want: 0x1b4, have: 0x139, distance: 0xa, oneway: true}, + 39: {want: 0x1b8, have: 0x139, distance: 0xa, oneway: true}, + 40: {want: 0x1d4, have: 0x15e, distance: 0xa, oneway: true}, + 41: {want: 0x1d7, have: 0x3e2, distance: 0xa, oneway: true}, + 42: {want: 0x1d9, have: 0x139, distance: 0xa, oneway: true}, + 43: {want: 0x1e7, have: 0x139, distance: 0xa, oneway: true}, + 44: {want: 0x1f8, have: 0x139, distance: 0xa, oneway: true}, + 45: {want: 0x20e, have: 0x1e1, distance: 0xa, oneway: true}, + 46: {want: 0x210, have: 0x139, distance: 0xa, oneway: true}, + 47: {want: 0x22d, have: 0x15e, distance: 0xa, oneway: true}, + 48: {want: 0x242, have: 0x3e2, distance: 0xa, oneway: true}, + 49: {want: 0x24a, have: 0x139, distance: 0xa, oneway: true}, + 50: {want: 0x251, have: 0x139, distance: 0xa, oneway: true}, + 51: {want: 0x265, have: 0x139, distance: 0xa, oneway: true}, + 52: {want: 0x274, have: 0x48a, distance: 0xa, oneway: true}, + 53: {want: 0x28a, have: 0x3e2, distance: 0xa, oneway: true}, + 54: {want: 0x28e, have: 0x1f9, distance: 0xa, oneway: true}, + 55: {want: 0x2a3, have: 0x139, distance: 0xa, oneway: true}, + 56: {want: 0x2b5, have: 0x15e, distance: 0xa, oneway: true}, + 57: {want: 0x2b8, have: 0x139, distance: 0xa, oneway: true}, + 58: {want: 0x2be, have: 0x139, distance: 0xa, oneway: true}, + 59: {want: 0x2c3, have: 0x15e, distance: 0xa, oneway: true}, + 60: {want: 0x2ed, have: 0x139, distance: 0xa, oneway: true}, + 61: {want: 0x2f1, have: 0x15e, distance: 0xa, oneway: true}, + 62: {want: 0x2fa, have: 0x139, distance: 0xa, oneway: true}, + 63: {want: 0x2ff, have: 0x7e, distance: 0xa, oneway: true}, + 64: {want: 0x304, have: 0x139, distance: 0xa, oneway: true}, + 65: {want: 0x30b, have: 0x3e2, distance: 0xa, oneway: true}, + 66: {want: 0x31b, have: 0x1be, distance: 0xa, oneway: true}, + 67: {want: 0x31f, have: 0x1e1, distance: 0xa, oneway: true}, + 68: {want: 0x320, have: 0x139, distance: 0xa, oneway: true}, + 69: {want: 0x331, have: 0x139, distance: 0xa, oneway: true}, + 70: {want: 0x351, have: 0x139, distance: 0xa, oneway: true}, + 71: {want: 0x36a, have: 0x347, distance: 0xa, oneway: false}, + 72: {want: 0x36a, have: 0x36f, distance: 0xa, oneway: true}, + 73: {want: 0x37a, have: 0x139, distance: 0xa, oneway: true}, + 74: {want: 0x387, have: 0x139, distance: 0xa, oneway: true}, + 75: {want: 0x389, have: 0x139, distance: 0xa, oneway: true}, + 76: {want: 0x38b, have: 0x15e, distance: 0xa, oneway: true}, + 77: {want: 0x390, have: 0x139, distance: 0xa, oneway: true}, + 78: {want: 0x395, have: 0x139, distance: 0xa, oneway: true}, + 79: {want: 0x39d, have: 0x139, distance: 0xa, oneway: true}, + 80: {want: 0x3a5, have: 0x139, distance: 0xa, oneway: true}, + 81: {want: 0x3be, have: 0x139, distance: 0xa, oneway: true}, + 82: {want: 0x3c4, have: 0x13e, distance: 0xa, oneway: true}, + 83: {want: 0x3d4, have: 0x10d, distance: 0xa, oneway: true}, + 84: {want: 0x3d9, have: 0x139, distance: 0xa, oneway: true}, + 85: {want: 0x3e5, have: 0x15e, distance: 0xa, oneway: true}, + 86: {want: 0x3e9, have: 0x1be, distance: 0xa, oneway: true}, + 87: {want: 0x3fa, have: 0x139, distance: 0xa, oneway: true}, + 88: {want: 0x40c, have: 0x139, distance: 0xa, oneway: true}, + 89: {want: 0x423, have: 0x139, distance: 0xa, oneway: true}, + 90: {want: 0x429, have: 0x139, distance: 0xa, oneway: true}, + 91: {want: 0x431, have: 0x139, distance: 0xa, oneway: true}, + 92: {want: 0x43b, have: 0x139, distance: 0xa, oneway: true}, + 93: {want: 0x43e, have: 0x1e1, distance: 0xa, oneway: true}, + 94: {want: 0x445, have: 0x139, distance: 0xa, oneway: true}, + 95: {want: 0x450, have: 0x139, distance: 0xa, oneway: true}, + 96: {want: 0x461, have: 0x139, distance: 0xa, oneway: true}, + 97: {want: 0x467, have: 0x3e2, distance: 0xa, oneway: true}, + 98: {want: 0x46f, have: 0x139, distance: 0xa, oneway: true}, + 99: {want: 0x476, have: 0x3e2, distance: 0xa, oneway: true}, + 100: {want: 0x3883, have: 0x139, distance: 0xa, oneway: true}, + 101: {want: 0x480, have: 0x139, distance: 0xa, oneway: true}, + 102: {want: 0x482, have: 0x139, distance: 0xa, oneway: true}, + 103: {want: 0x494, have: 0x3e2, distance: 0xa, oneway: true}, + 104: {want: 0x49d, have: 0x139, distance: 0xa, oneway: true}, + 105: {want: 0x4ac, have: 0x529, distance: 0xa, oneway: true}, + 106: {want: 0x4b4, have: 0x139, distance: 0xa, oneway: true}, + 107: {want: 0x4bc, have: 0x3e2, distance: 0xa, oneway: true}, + 108: {want: 0x4e5, have: 0x15e, distance: 0xa, oneway: true}, + 109: {want: 0x4f2, have: 0x139, distance: 0xa, oneway: true}, + 110: {want: 0x512, have: 0x139, distance: 0xa, oneway: true}, + 111: {want: 0x518, have: 0x139, distance: 0xa, oneway: true}, + 112: {want: 0x52f, have: 0x139, distance: 0xa, oneway: true}, +} // Size: 702 bytes + +// matchScript holds pairs of scriptIDs where readers of one script +// can typically also read the other. Each is associated with a confidence. +var matchScript = []scriptIntelligibility{ // 26 elements + 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5b, haveScript: 0x20, distance: 0x5}, + 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5b, distance: 0x5}, + 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5b, distance: 0xa}, + 4: {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x20, distance: 0xa}, + 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5b, distance: 0xa}, + 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4f, haveScript: 0x5b, distance: 0xa}, + 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x53, haveScript: 0x5b, distance: 0xa}, + 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x58, haveScript: 0x5b, distance: 0xa}, + 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6f, haveScript: 0x5b, distance: 0xa}, + 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x76, haveScript: 0x5b, distance: 0xa}, + 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5b, distance: 0xa}, + 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x83, haveScript: 0x5b, distance: 0xa}, + 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5b, distance: 0xa}, + 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd6, haveScript: 0x5b, distance: 0xa}, + 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5b, distance: 0xa}, + 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe9, haveScript: 0x5b, distance: 0xa}, + 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5b, distance: 0xa}, + 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5b, distance: 0xa}, + 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3b, haveScript: 0x3c, distance: 0xf}, + 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3c, haveScript: 0x3b, distance: 0x13}, +} // Size: 232 bytes + +var matchRegion = []regionIntelligibility{ // 15 elements + 0: {lang: 0x3a, script: 0x0, group: 0x4, distance: 0x4}, + 1: {lang: 0x3a, script: 0x0, group: 0x84, distance: 0x4}, + 2: {lang: 0x139, script: 0x0, group: 0x1, distance: 0x4}, + 3: {lang: 0x139, script: 0x0, group: 0x81, distance: 0x4}, + 4: {lang: 0x13e, script: 0x0, group: 0x3, distance: 0x4}, + 5: {lang: 0x13e, script: 0x0, group: 0x83, distance: 0x4}, + 6: {lang: 0x3c0, script: 0x0, group: 0x3, distance: 0x4}, + 7: {lang: 0x3c0, script: 0x0, group: 0x83, distance: 0x4}, + 8: {lang: 0x529, script: 0x3c, group: 0x2, distance: 0x4}, + 9: {lang: 0x529, script: 0x3c, group: 0x82, distance: 0x4}, + 10: {lang: 0x3a, script: 0x0, group: 0x80, distance: 0x5}, + 11: {lang: 0x139, script: 0x0, group: 0x80, distance: 0x5}, + 12: {lang: 0x13e, script: 0x0, group: 0x80, distance: 0x5}, + 13: {lang: 0x3c0, script: 0x0, group: 0x80, distance: 0x5}, + 14: {lang: 0x529, script: 0x3c, group: 0x80, distance: 0x5}, +} // Size: 114 bytes + +// Total table size 1473 bytes (1KiB); checksum: 7BB90B5C diff --git a/vendor/golang.org/x/text/language/tags.go b/vendor/golang.org/x/text/language/tags.go new file mode 100644 index 0000000..42ea792 --- /dev/null +++ b/vendor/golang.org/x/text/language/tags.go @@ -0,0 +1,145 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import "golang.org/x/text/internal/language/compact" + +// TODO: Various sets of commonly use tags and regions. + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func MustParse(s string) Tag { + t, err := Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func (c CanonType) MustParse(s string) Tag { + t, err := c.Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. +// It simplifies safe initialization of Base values. +func MustParseBase(s string) Base { + b, err := ParseBase(s) + if err != nil { + panic(err) + } + return b +} + +// MustParseScript is like ParseScript, but panics if the given script cannot be +// parsed. It simplifies safe initialization of Script values. +func MustParseScript(s string) Script { + scr, err := ParseScript(s) + if err != nil { + panic(err) + } + return scr +} + +// MustParseRegion is like ParseRegion, but panics if the given region cannot be +// parsed. It simplifies safe initialization of Region values. +func MustParseRegion(s string) Region { + r, err := ParseRegion(s) + if err != nil { + panic(err) + } + return r +} + +var ( + und = Tag{} + + Und Tag = Tag{} + + Afrikaans Tag = Tag(compact.Afrikaans) + Amharic Tag = Tag(compact.Amharic) + Arabic Tag = Tag(compact.Arabic) + ModernStandardArabic Tag = Tag(compact.ModernStandardArabic) + Azerbaijani Tag = Tag(compact.Azerbaijani) + Bulgarian Tag = Tag(compact.Bulgarian) + Bengali Tag = Tag(compact.Bengali) + Catalan Tag = Tag(compact.Catalan) + Czech Tag = Tag(compact.Czech) + Danish Tag = Tag(compact.Danish) + German Tag = Tag(compact.German) + Greek Tag = Tag(compact.Greek) + English Tag = Tag(compact.English) + AmericanEnglish Tag = Tag(compact.AmericanEnglish) + BritishEnglish Tag = Tag(compact.BritishEnglish) + Spanish Tag = Tag(compact.Spanish) + EuropeanSpanish Tag = Tag(compact.EuropeanSpanish) + LatinAmericanSpanish Tag = Tag(compact.LatinAmericanSpanish) + Estonian Tag = Tag(compact.Estonian) + Persian Tag = Tag(compact.Persian) + Finnish Tag = Tag(compact.Finnish) + Filipino Tag = Tag(compact.Filipino) + French Tag = Tag(compact.French) + CanadianFrench Tag = Tag(compact.CanadianFrench) + Gujarati Tag = Tag(compact.Gujarati) + Hebrew Tag = Tag(compact.Hebrew) + Hindi Tag = Tag(compact.Hindi) + Croatian Tag = Tag(compact.Croatian) + Hungarian Tag = Tag(compact.Hungarian) + Armenian Tag = Tag(compact.Armenian) + Indonesian Tag = Tag(compact.Indonesian) + Icelandic Tag = Tag(compact.Icelandic) + Italian Tag = Tag(compact.Italian) + Japanese Tag = Tag(compact.Japanese) + Georgian Tag = Tag(compact.Georgian) + Kazakh Tag = Tag(compact.Kazakh) + Khmer Tag = Tag(compact.Khmer) + Kannada Tag = Tag(compact.Kannada) + Korean Tag = Tag(compact.Korean) + Kirghiz Tag = Tag(compact.Kirghiz) + Lao Tag = Tag(compact.Lao) + Lithuanian Tag = Tag(compact.Lithuanian) + Latvian Tag = Tag(compact.Latvian) + Macedonian Tag = Tag(compact.Macedonian) + Malayalam Tag = Tag(compact.Malayalam) + Mongolian Tag = Tag(compact.Mongolian) + Marathi Tag = Tag(compact.Marathi) + Malay Tag = Tag(compact.Malay) + Burmese Tag = Tag(compact.Burmese) + Nepali Tag = Tag(compact.Nepali) + Dutch Tag = Tag(compact.Dutch) + Norwegian Tag = Tag(compact.Norwegian) + Punjabi Tag = Tag(compact.Punjabi) + Polish Tag = Tag(compact.Polish) + Portuguese Tag = Tag(compact.Portuguese) + BrazilianPortuguese Tag = Tag(compact.BrazilianPortuguese) + EuropeanPortuguese Tag = Tag(compact.EuropeanPortuguese) + Romanian Tag = Tag(compact.Romanian) + Russian Tag = Tag(compact.Russian) + Sinhala Tag = Tag(compact.Sinhala) + Slovak Tag = Tag(compact.Slovak) + Slovenian Tag = Tag(compact.Slovenian) + Albanian Tag = Tag(compact.Albanian) + Serbian Tag = Tag(compact.Serbian) + SerbianLatin Tag = Tag(compact.SerbianLatin) + Swedish Tag = Tag(compact.Swedish) + Swahili Tag = Tag(compact.Swahili) + Tamil Tag = Tag(compact.Tamil) + Telugu Tag = Tag(compact.Telugu) + Thai Tag = Tag(compact.Thai) + Turkish Tag = Tag(compact.Turkish) + Ukrainian Tag = Tag(compact.Ukrainian) + Urdu Tag = Tag(compact.Urdu) + Uzbek Tag = Tag(compact.Uzbek) + Vietnamese Tag = Tag(compact.Vietnamese) + Chinese Tag = Tag(compact.Chinese) + SimplifiedChinese Tag = Tag(compact.SimplifiedChinese) + TraditionalChinese Tag = Tag(compact.TraditionalChinese) + Zulu Tag = Tag(compact.Zulu) +) diff --git a/vendor/golang.org/x/text/message/catalog.go b/vendor/golang.org/x/text/message/catalog.go new file mode 100644 index 0000000..068271d --- /dev/null +++ b/vendor/golang.org/x/text/message/catalog.go @@ -0,0 +1,36 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package message + +// TODO: some types in this file will need to be made public at some time. +// Documentation and method names will reflect this by using the exported name. + +import ( + "golang.org/x/text/language" + "golang.org/x/text/message/catalog" +) + +// MatchLanguage reports the matched tag obtained from language.MatchStrings for +// the Matcher of the DefaultCatalog. +func MatchLanguage(preferred ...string) language.Tag { + c := DefaultCatalog + tag, _ := language.MatchStrings(c.Matcher(), preferred...) + return tag +} + +// DefaultCatalog is used by SetString. +var DefaultCatalog catalog.Catalog = defaultCatalog + +var defaultCatalog = catalog.NewBuilder() + +// SetString calls SetString on the initial default Catalog. +func SetString(tag language.Tag, key string, msg string) error { + return defaultCatalog.SetString(tag, key, msg) +} + +// Set calls Set on the initial default Catalog. +func Set(tag language.Tag, key string, msg ...catalog.Message) error { + return defaultCatalog.Set(tag, key, msg...) +} diff --git a/vendor/golang.org/x/text/message/catalog/catalog.go b/vendor/golang.org/x/text/message/catalog/catalog.go new file mode 100644 index 0000000..d06ba2f --- /dev/null +++ b/vendor/golang.org/x/text/message/catalog/catalog.go @@ -0,0 +1,365 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package catalog defines collections of translated format strings. +// +// This package mostly defines types for populating catalogs with messages. The +// catmsg package contains further definitions for creating custom message and +// dictionary types as well as packages that use Catalogs. +// +// Package catalog defines various interfaces: Dictionary, Loader, and Message. +// A Dictionary maintains a set of translations of format strings for a single +// language. The Loader interface defines a source of dictionaries. A +// translation of a format string is represented by a Message. +// +// # Catalogs +// +// A Catalog defines a programmatic interface for setting message translations. +// It maintains a set of per-language dictionaries with translations for a set +// of keys. For message translation to function properly, a translation should +// be defined for each key for each supported language. A dictionary may be +// underspecified, though, if there is a parent language that already defines +// the key. For example, a Dictionary for "en-GB" could leave out entries that +// are identical to those in a dictionary for "en". +// +// # Messages +// +// A Message is a format string which varies on the value of substitution +// variables. For instance, to indicate the number of results one could want "no +// results" if there are none, "1 result" if there is 1, and "%d results" for +// any other number. Catalog is agnostic to the kind of format strings that are +// used: for instance, messages can follow either the printf-style substitution +// from package fmt or use templates. +// +// A Message does not substitute arguments in the format string. This job is +// reserved for packages that render strings, such as message, that use Catalogs +// to selected string. This separation of concerns allows Catalog to be used to +// store any kind of formatting strings. +// +// # Selecting messages based on linguistic features of substitution arguments +// +// Messages may vary based on any linguistic features of the argument values. +// The most common one is plural form, but others exist. +// +// Selection messages are provided in packages that provide support for a +// specific linguistic feature. The following snippet uses plural.Selectf: +// +// catalog.Set(language.English, "You are %d minute(s) late.", +// plural.Selectf(1, "", +// plural.One, "You are 1 minute late.", +// plural.Other, "You are %d minutes late.")) +// +// In this example, a message is stored in the Catalog where one of two messages +// is selected based on the first argument, a number. The first message is +// selected if the argument is singular (identified by the selector "one") and +// the second message is selected in all other cases. The selectors are defined +// by the plural rules defined in CLDR. The selector "other" is special and will +// always match. Each language always defines one of the linguistic categories +// to be "other." For English, singular is "one" and plural is "other". +// +// Selects can be nested. This allows selecting sentences based on features of +// multiple arguments or multiple linguistic properties of a single argument. +// +// # String interpolation +// +// There is often a lot of commonality between the possible variants of a +// message. For instance, in the example above the word "minute" varies based on +// the plural catogory of the argument, but the rest of the sentence is +// identical. Using interpolation the above message can be rewritten as: +// +// catalog.Set(language.English, "You are %d minute(s) late.", +// catalog.Var("minutes", +// plural.Selectf(1, "", plural.One, "minute", plural.Other, "minutes")), +// catalog.String("You are %[1]d ${minutes} late.")) +// +// Var is defined to return the variable name if the message does not yield a +// match. This allows us to further simplify this snippet to +// +// catalog.Set(language.English, "You are %d minute(s) late.", +// catalog.Var("minutes", plural.Selectf(1, "", plural.One, "minute")), +// catalog.String("You are %d ${minutes} late.")) +// +// Overall this is still only a minor improvement, but things can get a lot more +// unwieldy if more than one linguistic feature is used to determine a message +// variant. Consider the following example: +// +// // argument 1: list of hosts, argument 2: list of guests +// catalog.Set(language.English, "%[1]v invite(s) %[2]v to their party.", +// catalog.Var("their", +// plural.Selectf(1, "" +// plural.One, gender.Select(1, "female", "her", "other", "his"))), +// catalog.Var("invites", plural.Selectf(1, "", plural.One, "invite")) +// catalog.String("%[1]v ${invites} %[2]v to ${their} party.")), +// +// Without variable substitution, this would have to be written as +// +// // argument 1: list of hosts, argument 2: list of guests +// catalog.Set(language.English, "%[1]v invite(s) %[2]v to their party.", +// plural.Selectf(1, "", +// plural.One, gender.Select(1, +// "female", "%[1]v invites %[2]v to her party." +// "other", "%[1]v invites %[2]v to his party."), +// plural.Other, "%[1]v invites %[2]v to their party.")) +// +// Not necessarily shorter, but using variables there is less duplication and +// the messages are more maintenance friendly. Moreover, languages may have up +// to six plural forms. This makes the use of variables more welcome. +// +// Different messages using the same inflections can reuse variables by moving +// them to macros. Using macros we can rewrite the message as: +// +// // argument 1: list of hosts, argument 2: list of guests +// catalog.SetString(language.English, "%[1]v invite(s) %[2]v to their party.", +// "%[1]v ${invites(1)} %[2]v to ${their(1)} party.") +// +// Where the following macros were defined separately. +// +// catalog.SetMacro(language.English, "invites", plural.Selectf(1, "", +// plural.One, "invite")) +// catalog.SetMacro(language.English, "their", plural.Selectf(1, "", +// plural.One, gender.Select(1, "female", "her", "other", "his"))), +// +// Placeholders use parentheses and the arguments to invoke a macro. +// +// # Looking up messages +// +// Message lookup using Catalogs is typically only done by specialized packages +// and is not something the user should be concerned with. For instance, to +// express the tardiness of a user using the related message we defined earlier, +// the user may use the package message like so: +// +// p := message.NewPrinter(language.English) +// p.Printf("You are %d minute(s) late.", 5) +// +// Which would print: +// +// You are 5 minutes late. +// +// This package is UNDER CONSTRUCTION and its API may change. +package catalog // import "golang.org/x/text/message/catalog" + +// TODO: +// Some way to freeze a catalog. +// - Locking on each lockup turns out to be about 50% of the total running time +// for some of the benchmarks in the message package. +// Consider these: +// - Sequence type to support sequences in user-defined messages. +// - Garbage collection: Remove dictionaries that can no longer be reached +// as other dictionaries have been added that cover all possible keys. + +import ( + "errors" + "fmt" + + "golang.org/x/text/internal" + + "golang.org/x/text/internal/catmsg" + "golang.org/x/text/language" +) + +// A Catalog allows lookup of translated messages. +type Catalog interface { + // Languages returns all languages for which the Catalog contains variants. + Languages() []language.Tag + + // Matcher returns a Matcher for languages from this Catalog. + Matcher() language.Matcher + + // A Context is used for evaluating Messages. + Context(tag language.Tag, r catmsg.Renderer) *Context + + // This method also makes Catalog a private interface. + lookup(tag language.Tag, key string) (data string, ok bool) +} + +// NewFromMap creates a Catalog from the given map. If a Dictionary is +// underspecified the entry is retrieved from a parent language. +func NewFromMap(dictionaries map[string]Dictionary, opts ...Option) (Catalog, error) { + options := options{} + for _, o := range opts { + o(&options) + } + c := &catalog{ + dicts: map[language.Tag]Dictionary{}, + } + _, hasFallback := dictionaries[options.fallback.String()] + if hasFallback { + // TODO: Should it be okay to not have a fallback language? + // Catalog generators could enforce there is always a fallback. + c.langs = append(c.langs, options.fallback) + } + for lang, dict := range dictionaries { + tag, err := language.Parse(lang) + if err != nil { + return nil, fmt.Errorf("catalog: invalid language tag %q", lang) + } + if _, ok := c.dicts[tag]; ok { + return nil, fmt.Errorf("catalog: duplicate entry for tag %q after normalization", tag) + } + c.dicts[tag] = dict + if !hasFallback || tag != options.fallback { + c.langs = append(c.langs, tag) + } + } + if hasFallback { + internal.SortTags(c.langs[1:]) + } else { + internal.SortTags(c.langs) + } + c.matcher = language.NewMatcher(c.langs) + return c, nil +} + +// A Dictionary is a source of translations for a single language. +type Dictionary interface { + // Lookup returns a message compiled with catmsg.Compile for the given key. + // It returns false for ok if such a message could not be found. + Lookup(key string) (data string, ok bool) +} + +type catalog struct { + langs []language.Tag + dicts map[language.Tag]Dictionary + macros store + matcher language.Matcher +} + +func (c *catalog) Languages() []language.Tag { return c.langs } +func (c *catalog) Matcher() language.Matcher { return c.matcher } + +func (c *catalog) lookup(tag language.Tag, key string) (data string, ok bool) { + for ; ; tag = tag.Parent() { + if dict, ok := c.dicts[tag]; ok { + if data, ok := dict.Lookup(key); ok { + return data, true + } + } + if tag == language.Und { + break + } + } + return "", false +} + +// Context returns a Context for formatting messages. +// Only one Message may be formatted per context at any given time. +func (c *catalog) Context(tag language.Tag, r catmsg.Renderer) *Context { + return &Context{ + cat: c, + tag: tag, + dec: catmsg.NewDecoder(tag, r, &dict{&c.macros, tag}), + } +} + +// A Builder allows building a Catalog programmatically. +type Builder struct { + options + matcher language.Matcher + + index store + macros store +} + +type options struct { + fallback language.Tag +} + +// An Option configures Catalog behavior. +type Option func(*options) + +// Fallback specifies the default fallback language. The default is Und. +func Fallback(tag language.Tag) Option { + return func(o *options) { o.fallback = tag } +} + +// TODO: +// // Catalogs specifies one or more sources for a Catalog. +// // Lookups are in order. +// // This can be changed inserting a Catalog used for setting, which implements +// // Loader, used for setting in the chain. +// func Catalogs(d ...Loader) Option { +// return nil +// } +// +// func Delims(start, end string) Option {} +// +// func Dict(tag language.Tag, d ...Dictionary) Option + +// NewBuilder returns an empty mutable Catalog. +func NewBuilder(opts ...Option) *Builder { + c := &Builder{} + for _, o := range opts { + o(&c.options) + } + return c +} + +// SetString is shorthand for Set(tag, key, String(msg)). +func (c *Builder) SetString(tag language.Tag, key string, msg string) error { + return c.set(tag, key, &c.index, String(msg)) +} + +// Set sets the translation for the given language and key. +// +// When evaluation this message, the first Message in the sequence to msgs to +// evaluate to a string will be the message returned. +func (c *Builder) Set(tag language.Tag, key string, msg ...Message) error { + return c.set(tag, key, &c.index, msg...) +} + +// SetMacro defines a Message that may be substituted in another message. +// The arguments to a macro Message are passed as arguments in the +// placeholder the form "${foo(arg1, arg2)}". +func (c *Builder) SetMacro(tag language.Tag, name string, msg ...Message) error { + return c.set(tag, name, &c.macros, msg...) +} + +// ErrNotFound indicates there was no message for the given key. +var ErrNotFound = errors.New("catalog: message not found") + +// String specifies a plain message string. It can be used as fallback if no +// other strings match or as a simple standalone message. +// +// It is an error to pass more than one String in a message sequence. +func String(name string) Message { + return catmsg.String(name) +} + +// Var sets a variable that may be substituted in formatting patterns using +// named substitution of the form "${name}". The name argument is used as a +// fallback if the statements do not produce a match. The statement sequence may +// not contain any Var calls. +// +// The name passed to a Var must be unique within message sequence. +func Var(name string, msg ...Message) Message { + return &catmsg.Var{Name: name, Message: catmsg.FirstOf(msg)} +} + +// Context returns a Context for formatting messages. +// Only one Message may be formatted per context at any given time. +func (b *Builder) Context(tag language.Tag, r catmsg.Renderer) *Context { + return &Context{ + cat: b, + tag: tag, + dec: catmsg.NewDecoder(tag, r, &dict{&b.macros, tag}), + } +} + +// A Context is used for evaluating Messages. +// Only one Message may be formatted per context at any given time. +type Context struct { + cat Catalog + tag language.Tag // TODO: use compact index. + dec *catmsg.Decoder +} + +// Execute looks up and executes the message with the given key. +// It returns ErrNotFound if no message could be found in the index. +func (c *Context) Execute(key string) error { + data, ok := c.cat.lookup(c.tag, key) + if !ok { + return ErrNotFound + } + return c.dec.Execute(data) +} diff --git a/vendor/golang.org/x/text/message/catalog/dict.go b/vendor/golang.org/x/text/message/catalog/dict.go new file mode 100644 index 0000000..1416e7b --- /dev/null +++ b/vendor/golang.org/x/text/message/catalog/dict.go @@ -0,0 +1,133 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package catalog + +import ( + "sync" + + "golang.org/x/text/internal" + "golang.org/x/text/internal/catmsg" + "golang.org/x/text/language" +) + +// A Message holds a collection of translations for the same phrase that may +// vary based on the values of substitution arguments. +type Message = catmsg.Message + +// TODO: +// Dictionary returns a Dictionary that returns the first Message, using the +// given language tag, that matches: +// 1. the last one registered by one of the Set methods +// 2. returned by one of the Loaders +// 3. repeat from 1. using the parent language +// This approach allows messages to be underspecified. +// func (c *Catalog) Dictionary(tag language.Tag) (Dictionary, error) { +// // TODO: verify dictionary exists. +// return &dict{&c.index, tag}, nil +// } + +type dict struct { + s *store + tag language.Tag // TODO: make compact tag. +} + +func (d *dict) Lookup(key string) (data string, ok bool) { + return d.s.lookup(d.tag, key) +} + +func (b *Builder) lookup(tag language.Tag, key string) (data string, ok bool) { + return b.index.lookup(tag, key) +} + +func (c *Builder) set(tag language.Tag, key string, s *store, msg ...Message) error { + data, err := catmsg.Compile(tag, &dict{&c.macros, tag}, catmsg.FirstOf(msg)) + + s.mutex.Lock() + defer s.mutex.Unlock() + + m := s.index[tag] + if m == nil { + m = msgMap{} + if s.index == nil { + s.index = map[language.Tag]msgMap{} + } + c.matcher = nil + s.index[tag] = m + } + + m[key] = data + return err +} + +func (c *Builder) Matcher() language.Matcher { + c.index.mutex.RLock() + m := c.matcher + c.index.mutex.RUnlock() + if m != nil { + return m + } + + c.index.mutex.Lock() + if c.matcher == nil { + c.matcher = language.NewMatcher(c.unlockedLanguages()) + } + m = c.matcher + c.index.mutex.Unlock() + return m +} + +type store struct { + mutex sync.RWMutex + index map[language.Tag]msgMap +} + +type msgMap map[string]string + +func (s *store) lookup(tag language.Tag, key string) (data string, ok bool) { + s.mutex.RLock() + defer s.mutex.RUnlock() + + for ; ; tag = tag.Parent() { + if msgs, ok := s.index[tag]; ok { + if msg, ok := msgs[key]; ok { + return msg, true + } + } + if tag == language.Und { + break + } + } + return "", false +} + +// Languages returns all languages for which the Catalog contains variants. +func (b *Builder) Languages() []language.Tag { + s := &b.index + s.mutex.RLock() + defer s.mutex.RUnlock() + + return b.unlockedLanguages() +} + +func (b *Builder) unlockedLanguages() []language.Tag { + s := &b.index + if len(s.index) == 0 { + return nil + } + tags := make([]language.Tag, 0, len(s.index)) + _, hasFallback := s.index[b.options.fallback] + offset := 0 + if hasFallback { + tags = append(tags, b.options.fallback) + offset = 1 + } + for t := range s.index { + if t != b.options.fallback { + tags = append(tags, t) + } + } + internal.SortTags(tags[offset:]) + return tags +} diff --git a/vendor/golang.org/x/text/message/doc.go b/vendor/golang.org/x/text/message/doc.go new file mode 100644 index 0000000..4bf7bdc --- /dev/null +++ b/vendor/golang.org/x/text/message/doc.go @@ -0,0 +1,99 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package message implements formatted I/O for localized strings with functions +// analogous to the fmt's print functions. It is a drop-in replacement for fmt. +// +// # Localized Formatting +// +// A format string can be localized by replacing any of the print functions of +// fmt with an equivalent call to a Printer. +// +// p := message.NewPrinter(message.MatchLanguage("en")) +// p.Println(123456.78) // Prints 123,456.78 +// +// p.Printf("%d ducks in a row", 4331) // Prints 4,331 ducks in a row +// +// p := message.NewPrinter(message.MatchLanguage("nl")) +// p.Printf("Hoogte: %.1f meter", 1244.9) // Prints Hoogte: 1,244.9 meter +// +// p := message.NewPrinter(message.MatchLanguage("bn")) +// p.Println(123456.78) // Prints ১,২৩,৪৫৬.৭৮ +// +// Printer currently supports numbers and specialized types for which packages +// exist in x/text. Other builtin types such as time.Time and slices are +// planned. +// +// Format strings largely have the same meaning as with fmt with the following +// notable exceptions: +// - flag # always resorts to fmt for printing +// - verb 'f', 'e', 'g', 'd' use localized formatting unless the '#' flag is +// specified. +// - verb 'm' inserts a translation of a string argument. +// +// See package fmt for more options. +// +// # Translation +// +// The format strings that are passed to Printf, Sprintf, Fprintf, or Errorf +// are used as keys to look up translations for the specified languages. +// More on how these need to be specified below. +// +// One can use arbitrary keys to distinguish between otherwise ambiguous +// strings: +// +// p := message.NewPrinter(language.English) +// p.Printf("archive(noun)") // Prints "archive" +// p.Printf("archive(verb)") // Prints "archive" +// +// p := message.NewPrinter(language.German) +// p.Printf("archive(noun)") // Prints "Archiv" +// p.Printf("archive(verb)") // Prints "archivieren" +// +// To retain the fallback functionality, use Key: +// +// p.Printf(message.Key("archive(noun)", "archive")) +// p.Printf(message.Key("archive(verb)", "archive")) +// +// # Translation Pipeline +// +// Format strings that contain text need to be translated to support different +// locales. The first step is to extract strings that need to be translated. +// +// 1. Install gotext +// +// go get -u golang.org/x/text/cmd/gotext +// gotext -help +// +// 2. Mark strings in your source to be translated by using message.Printer, +// instead of the functions of the fmt package. +// +// 3. Extract the strings from your source +// +// gotext extract +// +// The output will be written to the textdata directory. +// +// 4. Send the files for translation +// +// It is planned to support multiple formats, but for now one will have to +// rewrite the JSON output to the desired format. +// +// 5. Inject translations into program +// +// 6. Repeat from 2 +// +// Right now this has to be done programmatically with calls to Set or +// SetString. These functions as well as the methods defined in +// see also package golang.org/x/text/message/catalog can be used to implement +// either dynamic or static loading of messages. +// +// # Plural and Gender Forms +// +// Translated messages can vary based on the plural and gender forms of +// substitution values. In general, it is up to the translators to provide +// alternative translations for such forms. See the packages in +// golang.org/x/text/feature and golang.org/x/text/message/catalog for more +// information. +package message diff --git a/vendor/golang.org/x/text/message/format.go b/vendor/golang.org/x/text/message/format.go new file mode 100644 index 0000000..a47d17d --- /dev/null +++ b/vendor/golang.org/x/text/message/format.go @@ -0,0 +1,510 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package message + +import ( + "bytes" + "strconv" + "unicode/utf8" + + "golang.org/x/text/internal/format" +) + +const ( + ldigits = "0123456789abcdefx" + udigits = "0123456789ABCDEFX" +) + +const ( + signed = true + unsigned = false +) + +// A formatInfo is the raw formatter used by Printf etc. +// It prints into a buffer that must be set up separately. +type formatInfo struct { + buf *bytes.Buffer + + format.Parser + + // intbuf is large enough to store %b of an int64 with a sign and + // avoids padding at the end of the struct on 32 bit architectures. + intbuf [68]byte +} + +func (f *formatInfo) init(buf *bytes.Buffer) { + f.ClearFlags() + f.buf = buf +} + +// writePadding generates n bytes of padding. +func (f *formatInfo) writePadding(n int) { + if n <= 0 { // No padding bytes needed. + return + } + f.buf.Grow(n) + // Decide which byte the padding should be filled with. + padByte := byte(' ') + if f.Zero { + padByte = byte('0') + } + // Fill padding with padByte. + for i := 0; i < n; i++ { + f.buf.WriteByte(padByte) // TODO: make more efficient. + } +} + +// pad appends b to f.buf, padded on left (!f.minus) or right (f.minus). +func (f *formatInfo) pad(b []byte) { + if !f.WidthPresent || f.Width == 0 { + f.buf.Write(b) + return + } + width := f.Width - utf8.RuneCount(b) + if !f.Minus { + // left padding + f.writePadding(width) + f.buf.Write(b) + } else { + // right padding + f.buf.Write(b) + f.writePadding(width) + } +} + +// padString appends s to f.buf, padded on left (!f.minus) or right (f.minus). +func (f *formatInfo) padString(s string) { + if !f.WidthPresent || f.Width == 0 { + f.buf.WriteString(s) + return + } + width := f.Width - utf8.RuneCountInString(s) + if !f.Minus { + // left padding + f.writePadding(width) + f.buf.WriteString(s) + } else { + // right padding + f.buf.WriteString(s) + f.writePadding(width) + } +} + +// fmt_boolean formats a boolean. +func (f *formatInfo) fmt_boolean(v bool) { + if v { + f.padString("true") + } else { + f.padString("false") + } +} + +// fmt_unicode formats a uint64 as "U+0078" or with f.sharp set as "U+0078 'x'". +func (f *formatInfo) fmt_unicode(u uint64) { + buf := f.intbuf[0:] + + // With default precision set the maximum needed buf length is 18 + // for formatting -1 with %#U ("U+FFFFFFFFFFFFFFFF") which fits + // into the already allocated intbuf with a capacity of 68 bytes. + prec := 4 + if f.PrecPresent && f.Prec > 4 { + prec = f.Prec + // Compute space needed for "U+" , number, " '", character, "'". + width := 2 + prec + 2 + utf8.UTFMax + 1 + if width > len(buf) { + buf = make([]byte, width) + } + } + + // Format into buf, ending at buf[i]. Formatting numbers is easier right-to-left. + i := len(buf) + + // For %#U we want to add a space and a quoted character at the end of the buffer. + if f.Sharp && u <= utf8.MaxRune && strconv.IsPrint(rune(u)) { + i-- + buf[i] = '\'' + i -= utf8.RuneLen(rune(u)) + utf8.EncodeRune(buf[i:], rune(u)) + i-- + buf[i] = '\'' + i-- + buf[i] = ' ' + } + // Format the Unicode code point u as a hexadecimal number. + for u >= 16 { + i-- + buf[i] = udigits[u&0xF] + prec-- + u >>= 4 + } + i-- + buf[i] = udigits[u] + prec-- + // Add zeros in front of the number until requested precision is reached. + for prec > 0 { + i-- + buf[i] = '0' + prec-- + } + // Add a leading "U+". + i-- + buf[i] = '+' + i-- + buf[i] = 'U' + + oldZero := f.Zero + f.Zero = false + f.pad(buf[i:]) + f.Zero = oldZero +} + +// fmt_integer formats signed and unsigned integers. +func (f *formatInfo) fmt_integer(u uint64, base int, isSigned bool, digits string) { + negative := isSigned && int64(u) < 0 + if negative { + u = -u + } + + buf := f.intbuf[0:] + // The already allocated f.intbuf with a capacity of 68 bytes + // is large enough for integer formatting when no precision or width is set. + if f.WidthPresent || f.PrecPresent { + // Account 3 extra bytes for possible addition of a sign and "0x". + width := 3 + f.Width + f.Prec // wid and prec are always positive. + if width > len(buf) { + // We're going to need a bigger boat. + buf = make([]byte, width) + } + } + + // Two ways to ask for extra leading zero digits: %.3d or %03d. + // If both are specified the f.zero flag is ignored and + // padding with spaces is used instead. + prec := 0 + if f.PrecPresent { + prec = f.Prec + // Precision of 0 and value of 0 means "print nothing" but padding. + if prec == 0 && u == 0 { + oldZero := f.Zero + f.Zero = false + f.writePadding(f.Width) + f.Zero = oldZero + return + } + } else if f.Zero && f.WidthPresent { + prec = f.Width + if negative || f.Plus || f.Space { + prec-- // leave room for sign + } + } + + // Because printing is easier right-to-left: format u into buf, ending at buf[i]. + // We could make things marginally faster by splitting the 32-bit case out + // into a separate block but it's not worth the duplication, so u has 64 bits. + i := len(buf) + // Use constants for the division and modulo for more efficient code. + // Switch cases ordered by popularity. + switch base { + case 10: + for u >= 10 { + i-- + next := u / 10 + buf[i] = byte('0' + u - next*10) + u = next + } + case 16: + for u >= 16 { + i-- + buf[i] = digits[u&0xF] + u >>= 4 + } + case 8: + for u >= 8 { + i-- + buf[i] = byte('0' + u&7) + u >>= 3 + } + case 2: + for u >= 2 { + i-- + buf[i] = byte('0' + u&1) + u >>= 1 + } + default: + panic("fmt: unknown base; can't happen") + } + i-- + buf[i] = digits[u] + for i > 0 && prec > len(buf)-i { + i-- + buf[i] = '0' + } + + // Various prefixes: 0x, -, etc. + if f.Sharp { + switch base { + case 8: + if buf[i] != '0' { + i-- + buf[i] = '0' + } + case 16: + // Add a leading 0x or 0X. + i-- + buf[i] = digits[16] + i-- + buf[i] = '0' + } + } + + if negative { + i-- + buf[i] = '-' + } else if f.Plus { + i-- + buf[i] = '+' + } else if f.Space { + i-- + buf[i] = ' ' + } + + // Left padding with zeros has already been handled like precision earlier + // or the f.zero flag is ignored due to an explicitly set precision. + oldZero := f.Zero + f.Zero = false + f.pad(buf[i:]) + f.Zero = oldZero +} + +// truncate truncates the string to the specified precision, if present. +func (f *formatInfo) truncate(s string) string { + if f.PrecPresent { + n := f.Prec + for i := range s { + n-- + if n < 0 { + return s[:i] + } + } + } + return s +} + +// fmt_s formats a string. +func (f *formatInfo) fmt_s(s string) { + s = f.truncate(s) + f.padString(s) +} + +// fmt_sbx formats a string or byte slice as a hexadecimal encoding of its bytes. +func (f *formatInfo) fmt_sbx(s string, b []byte, digits string) { + length := len(b) + if b == nil { + // No byte slice present. Assume string s should be encoded. + length = len(s) + } + // Set length to not process more bytes than the precision demands. + if f.PrecPresent && f.Prec < length { + length = f.Prec + } + // Compute width of the encoding taking into account the f.sharp and f.space flag. + width := 2 * length + if width > 0 { + if f.Space { + // Each element encoded by two hexadecimals will get a leading 0x or 0X. + if f.Sharp { + width *= 2 + } + // Elements will be separated by a space. + width += length - 1 + } else if f.Sharp { + // Only a leading 0x or 0X will be added for the whole string. + width += 2 + } + } else { // The byte slice or string that should be encoded is empty. + if f.WidthPresent { + f.writePadding(f.Width) + } + return + } + // Handle padding to the left. + if f.WidthPresent && f.Width > width && !f.Minus { + f.writePadding(f.Width - width) + } + // Write the encoding directly into the output buffer. + buf := f.buf + if f.Sharp { + // Add leading 0x or 0X. + buf.WriteByte('0') + buf.WriteByte(digits[16]) + } + var c byte + for i := 0; i < length; i++ { + if f.Space && i > 0 { + // Separate elements with a space. + buf.WriteByte(' ') + if f.Sharp { + // Add leading 0x or 0X for each element. + buf.WriteByte('0') + buf.WriteByte(digits[16]) + } + } + if b != nil { + c = b[i] // Take a byte from the input byte slice. + } else { + c = s[i] // Take a byte from the input string. + } + // Encode each byte as two hexadecimal digits. + buf.WriteByte(digits[c>>4]) + buf.WriteByte(digits[c&0xF]) + } + // Handle padding to the right. + if f.WidthPresent && f.Width > width && f.Minus { + f.writePadding(f.Width - width) + } +} + +// fmt_sx formats a string as a hexadecimal encoding of its bytes. +func (f *formatInfo) fmt_sx(s, digits string) { + f.fmt_sbx(s, nil, digits) +} + +// fmt_bx formats a byte slice as a hexadecimal encoding of its bytes. +func (f *formatInfo) fmt_bx(b []byte, digits string) { + f.fmt_sbx("", b, digits) +} + +// fmt_q formats a string as a double-quoted, escaped Go string constant. +// If f.sharp is set a raw (backquoted) string may be returned instead +// if the string does not contain any control characters other than tab. +func (f *formatInfo) fmt_q(s string) { + s = f.truncate(s) + if f.Sharp && strconv.CanBackquote(s) { + f.padString("`" + s + "`") + return + } + buf := f.intbuf[:0] + if f.Plus { + f.pad(strconv.AppendQuoteToASCII(buf, s)) + } else { + f.pad(strconv.AppendQuote(buf, s)) + } +} + +// fmt_c formats an integer as a Unicode character. +// If the character is not valid Unicode, it will print '\ufffd'. +func (f *formatInfo) fmt_c(c uint64) { + r := rune(c) + if c > utf8.MaxRune { + r = utf8.RuneError + } + buf := f.intbuf[:0] + w := utf8.EncodeRune(buf[:utf8.UTFMax], r) + f.pad(buf[:w]) +} + +// fmt_qc formats an integer as a single-quoted, escaped Go character constant. +// If the character is not valid Unicode, it will print '\ufffd'. +func (f *formatInfo) fmt_qc(c uint64) { + r := rune(c) + if c > utf8.MaxRune { + r = utf8.RuneError + } + buf := f.intbuf[:0] + if f.Plus { + f.pad(strconv.AppendQuoteRuneToASCII(buf, r)) + } else { + f.pad(strconv.AppendQuoteRune(buf, r)) + } +} + +// fmt_float formats a float64. It assumes that verb is a valid format specifier +// for strconv.AppendFloat and therefore fits into a byte. +func (f *formatInfo) fmt_float(v float64, size int, verb rune, prec int) { + // Explicit precision in format specifier overrules default precision. + if f.PrecPresent { + prec = f.Prec + } + // Format number, reserving space for leading + sign if needed. + num := strconv.AppendFloat(f.intbuf[:1], v, byte(verb), prec, size) + if num[1] == '-' || num[1] == '+' { + num = num[1:] + } else { + num[0] = '+' + } + // f.space means to add a leading space instead of a "+" sign unless + // the sign is explicitly asked for by f.plus. + if f.Space && num[0] == '+' && !f.Plus { + num[0] = ' ' + } + // Special handling for infinities and NaN, + // which don't look like a number so shouldn't be padded with zeros. + if num[1] == 'I' || num[1] == 'N' { + oldZero := f.Zero + f.Zero = false + // Remove sign before NaN if not asked for. + if num[1] == 'N' && !f.Space && !f.Plus { + num = num[1:] + } + f.pad(num) + f.Zero = oldZero + return + } + // The sharp flag forces printing a decimal point for non-binary formats + // and retains trailing zeros, which we may need to restore. + if f.Sharp && verb != 'b' { + digits := 0 + switch verb { + case 'v', 'g', 'G': + digits = prec + // If no precision is set explicitly use a precision of 6. + if digits == -1 { + digits = 6 + } + } + + // Buffer pre-allocated with enough room for + // exponent notations of the form "e+123". + var tailBuf [5]byte + tail := tailBuf[:0] + + hasDecimalPoint := false + // Starting from i = 1 to skip sign at num[0]. + for i := 1; i < len(num); i++ { + switch num[i] { + case '.': + hasDecimalPoint = true + case 'e', 'E': + tail = append(tail, num[i:]...) + num = num[:i] + default: + digits-- + } + } + if !hasDecimalPoint { + num = append(num, '.') + } + for digits > 0 { + num = append(num, '0') + digits-- + } + num = append(num, tail...) + } + // We want a sign if asked for and if the sign is not positive. + if f.Plus || num[0] != '+' { + // If we're zero padding to the left we want the sign before the leading zeros. + // Achieve this by writing the sign out and then padding the unsigned number. + if f.Zero && f.WidthPresent && f.Width > len(num) { + f.buf.WriteByte(num[0]) + f.writePadding(f.Width - len(num)) + f.buf.Write(num[1:]) + return + } + f.pad(num) + return + } + // No sign to show and the number is positive; just print the unsigned number. + f.pad(num[1:]) +} diff --git a/vendor/golang.org/x/text/message/message.go b/vendor/golang.org/x/text/message/message.go new file mode 100644 index 0000000..91a9726 --- /dev/null +++ b/vendor/golang.org/x/text/message/message.go @@ -0,0 +1,192 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package message // import "golang.org/x/text/message" + +import ( + "io" + "os" + + // Include features to facilitate generated catalogs. + _ "golang.org/x/text/feature/plural" + + "golang.org/x/text/internal/number" + "golang.org/x/text/language" + "golang.org/x/text/message/catalog" +) + +// A Printer implements language-specific formatted I/O analogous to the fmt +// package. +type Printer struct { + // the language + tag language.Tag + + toDecimal number.Formatter + toScientific number.Formatter + + cat catalog.Catalog +} + +type options struct { + cat catalog.Catalog + // TODO: + // - allow %s to print integers in written form (tables are likely too large + // to enable this by default). + // - list behavior + // +} + +// An Option defines an option of a Printer. +type Option func(o *options) + +// Catalog defines the catalog to be used. +func Catalog(c catalog.Catalog) Option { + return func(o *options) { o.cat = c } +} + +// NewPrinter returns a Printer that formats messages tailored to language t. +func NewPrinter(t language.Tag, opts ...Option) *Printer { + options := &options{ + cat: DefaultCatalog, + } + for _, o := range opts { + o(options) + } + p := &Printer{ + tag: t, + cat: options.cat, + } + p.toDecimal.InitDecimal(t) + p.toScientific.InitScientific(t) + return p +} + +// Sprint is like fmt.Sprint, but using language-specific formatting. +func (p *Printer) Sprint(a ...interface{}) string { + pp := newPrinter(p) + pp.doPrint(a) + s := pp.String() + pp.free() + return s +} + +// Fprint is like fmt.Fprint, but using language-specific formatting. +func (p *Printer) Fprint(w io.Writer, a ...interface{}) (n int, err error) { + pp := newPrinter(p) + pp.doPrint(a) + n64, err := io.Copy(w, &pp.Buffer) + pp.free() + return int(n64), err +} + +// Print is like fmt.Print, but using language-specific formatting. +func (p *Printer) Print(a ...interface{}) (n int, err error) { + return p.Fprint(os.Stdout, a...) +} + +// Sprintln is like fmt.Sprintln, but using language-specific formatting. +func (p *Printer) Sprintln(a ...interface{}) string { + pp := newPrinter(p) + pp.doPrintln(a) + s := pp.String() + pp.free() + return s +} + +// Fprintln is like fmt.Fprintln, but using language-specific formatting. +func (p *Printer) Fprintln(w io.Writer, a ...interface{}) (n int, err error) { + pp := newPrinter(p) + pp.doPrintln(a) + n64, err := io.Copy(w, &pp.Buffer) + pp.free() + return int(n64), err +} + +// Println is like fmt.Println, but using language-specific formatting. +func (p *Printer) Println(a ...interface{}) (n int, err error) { + return p.Fprintln(os.Stdout, a...) +} + +// Sprintf is like fmt.Sprintf, but using language-specific formatting. +func (p *Printer) Sprintf(key Reference, a ...interface{}) string { + pp := newPrinter(p) + lookupAndFormat(pp, key, a) + s := pp.String() + pp.free() + return s +} + +// Fprintf is like fmt.Fprintf, but using language-specific formatting. +func (p *Printer) Fprintf(w io.Writer, key Reference, a ...interface{}) (n int, err error) { + pp := newPrinter(p) + lookupAndFormat(pp, key, a) + n, err = w.Write(pp.Bytes()) + pp.free() + return n, err + +} + +// Printf is like fmt.Printf, but using language-specific formatting. +func (p *Printer) Printf(key Reference, a ...interface{}) (n int, err error) { + pp := newPrinter(p) + lookupAndFormat(pp, key, a) + n, err = os.Stdout.Write(pp.Bytes()) + pp.free() + return n, err +} + +func lookupAndFormat(p *printer, r Reference, a []interface{}) { + p.fmt.Reset(a) + switch v := r.(type) { + case string: + if p.catContext.Execute(v) == catalog.ErrNotFound { + p.Render(v) + return + } + case key: + if p.catContext.Execute(v.id) == catalog.ErrNotFound && + p.catContext.Execute(v.fallback) == catalog.ErrNotFound { + p.Render(v.fallback) + return + } + default: + panic("key argument is not a Reference") + } +} + +type rawPrinter struct { + p *printer +} + +func (p rawPrinter) Render(msg string) { p.p.WriteString(msg) } +func (p rawPrinter) Arg(i int) interface{} { return nil } + +// Arg implements catmsg.Renderer. +func (p *printer) Arg(i int) interface{} { // TODO, also return "ok" bool + i-- + if uint(i) < uint(len(p.fmt.Args)) { + return p.fmt.Args[i] + } + return nil +} + +// Render implements catmsg.Renderer. +func (p *printer) Render(msg string) { + p.doPrintf(msg) +} + +// A Reference is a string or a message reference. +type Reference interface { + // TODO: also allow []string +} + +// Key creates a message Reference for a message where the given id is used for +// message lookup and the fallback is returned when no matches are found. +func Key(id string, fallback string) Reference { + return key{id, fallback} +} + +type key struct { + id, fallback string +} diff --git a/vendor/golang.org/x/text/message/print.go b/vendor/golang.org/x/text/message/print.go new file mode 100644 index 0000000..da304cc --- /dev/null +++ b/vendor/golang.org/x/text/message/print.go @@ -0,0 +1,984 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package message + +import ( + "bytes" + "fmt" // TODO: consider copying interfaces from package fmt to avoid dependency. + "math" + "reflect" + "sync" + "unicode/utf8" + + "golang.org/x/text/internal/format" + "golang.org/x/text/internal/number" + "golang.org/x/text/language" + "golang.org/x/text/message/catalog" +) + +// Strings for use with buffer.WriteString. +// This is less overhead than using buffer.Write with byte arrays. +const ( + commaSpaceString = ", " + nilAngleString = "" + nilParenString = "(nil)" + nilString = "nil" + mapString = "map[" + percentBangString = "%!" + missingString = "(MISSING)" + badIndexString = "(BADINDEX)" + panicString = "(PANIC=" + extraString = "%!(EXTRA " + badWidthString = "%!(BADWIDTH)" + badPrecString = "%!(BADPREC)" + noVerbString = "%!(NOVERB)" + + invReflectString = "" +) + +var printerPool = sync.Pool{ + New: func() interface{} { return new(printer) }, +} + +// newPrinter allocates a new printer struct or grabs a cached one. +func newPrinter(pp *Printer) *printer { + p := printerPool.Get().(*printer) + p.Printer = *pp + // TODO: cache most of the following call. + p.catContext = pp.cat.Context(pp.tag, p) + + p.panicking = false + p.erroring = false + p.fmt.init(&p.Buffer) + return p +} + +// free saves used printer structs in printerFree; avoids an allocation per invocation. +func (p *printer) free() { + p.Buffer.Reset() + p.arg = nil + p.value = reflect.Value{} + printerPool.Put(p) +} + +// printer is used to store a printer's state. +// It implements "golang.org/x/text/internal/format".State. +type printer struct { + Printer + + // the context for looking up message translations + catContext *catalog.Context + + // buffer for accumulating output. + bytes.Buffer + + // arg holds the current item, as an interface{}. + arg interface{} + // value is used instead of arg for reflect values. + value reflect.Value + + // fmt is used to format basic items such as integers or strings. + fmt formatInfo + + // panicking is set by catchPanic to avoid infinite panic, recover, panic, ... recursion. + panicking bool + // erroring is set when printing an error string to guard against calling handleMethods. + erroring bool +} + +// Language implements "golang.org/x/text/internal/format".State. +func (p *printer) Language() language.Tag { return p.tag } + +func (p *printer) Width() (wid int, ok bool) { return p.fmt.Width, p.fmt.WidthPresent } + +func (p *printer) Precision() (prec int, ok bool) { return p.fmt.Prec, p.fmt.PrecPresent } + +func (p *printer) Flag(b int) bool { + switch b { + case '-': + return p.fmt.Minus + case '+': + return p.fmt.Plus || p.fmt.PlusV + case '#': + return p.fmt.Sharp || p.fmt.SharpV + case ' ': + return p.fmt.Space + case '0': + return p.fmt.Zero + } + return false +} + +// getField gets the i'th field of the struct value. +// If the field is itself is an interface, return a value for +// the thing inside the interface, not the interface itself. +func getField(v reflect.Value, i int) reflect.Value { + val := v.Field(i) + if val.Kind() == reflect.Interface && !val.IsNil() { + val = val.Elem() + } + return val +} + +func (p *printer) unknownType(v reflect.Value) { + if !v.IsValid() { + p.WriteString(nilAngleString) + return + } + p.WriteByte('?') + p.WriteString(v.Type().String()) + p.WriteByte('?') +} + +func (p *printer) badVerb(verb rune) { + p.erroring = true + p.WriteString(percentBangString) + p.WriteRune(verb) + p.WriteByte('(') + switch { + case p.arg != nil: + p.WriteString(reflect.TypeOf(p.arg).String()) + p.WriteByte('=') + p.printArg(p.arg, 'v') + case p.value.IsValid(): + p.WriteString(p.value.Type().String()) + p.WriteByte('=') + p.printValue(p.value, 'v', 0) + default: + p.WriteString(nilAngleString) + } + p.WriteByte(')') + p.erroring = false +} + +func (p *printer) fmtBool(v bool, verb rune) { + switch verb { + case 't', 'v': + p.fmt.fmt_boolean(v) + default: + p.badVerb(verb) + } +} + +// fmt0x64 formats a uint64 in hexadecimal and prefixes it with 0x or +// not, as requested, by temporarily setting the sharp flag. +func (p *printer) fmt0x64(v uint64, leading0x bool) { + sharp := p.fmt.Sharp + p.fmt.Sharp = leading0x + p.fmt.fmt_integer(v, 16, unsigned, ldigits) + p.fmt.Sharp = sharp +} + +// fmtInteger formats a signed or unsigned integer. +func (p *printer) fmtInteger(v uint64, isSigned bool, verb rune) { + switch verb { + case 'v': + if p.fmt.SharpV && !isSigned { + p.fmt0x64(v, true) + return + } + fallthrough + case 'd': + if p.fmt.Sharp || p.fmt.SharpV { + p.fmt.fmt_integer(v, 10, isSigned, ldigits) + } else { + p.fmtDecimalInt(v, isSigned) + } + case 'b': + p.fmt.fmt_integer(v, 2, isSigned, ldigits) + case 'o': + p.fmt.fmt_integer(v, 8, isSigned, ldigits) + case 'x': + p.fmt.fmt_integer(v, 16, isSigned, ldigits) + case 'X': + p.fmt.fmt_integer(v, 16, isSigned, udigits) + case 'c': + p.fmt.fmt_c(v) + case 'q': + if v <= utf8.MaxRune { + p.fmt.fmt_qc(v) + } else { + p.badVerb(verb) + } + case 'U': + p.fmt.fmt_unicode(v) + default: + p.badVerb(verb) + } +} + +// fmtFloat formats a float. The default precision for each verb +// is specified as last argument in the call to fmt_float. +func (p *printer) fmtFloat(v float64, size int, verb rune) { + switch verb { + case 'b': + p.fmt.fmt_float(v, size, verb, -1) + case 'v': + verb = 'g' + fallthrough + case 'g', 'G': + if p.fmt.Sharp || p.fmt.SharpV { + p.fmt.fmt_float(v, size, verb, -1) + } else { + p.fmtVariableFloat(v, size) + } + case 'e', 'E': + if p.fmt.Sharp || p.fmt.SharpV { + p.fmt.fmt_float(v, size, verb, 6) + } else { + p.fmtScientific(v, size, 6) + } + case 'f', 'F': + if p.fmt.Sharp || p.fmt.SharpV { + p.fmt.fmt_float(v, size, verb, 6) + } else { + p.fmtDecimalFloat(v, size, 6) + } + default: + p.badVerb(verb) + } +} + +func (p *printer) setFlags(f *number.Formatter) { + f.Flags &^= number.ElideSign + if p.fmt.Plus || p.fmt.Space { + f.Flags |= number.AlwaysSign + if !p.fmt.Plus { + f.Flags |= number.ElideSign + } + } else { + f.Flags &^= number.AlwaysSign + } +} + +func (p *printer) updatePadding(f *number.Formatter) { + f.Flags &^= number.PadMask + if p.fmt.Minus { + f.Flags |= number.PadAfterSuffix + } else { + f.Flags |= number.PadBeforePrefix + } + f.PadRune = ' ' + f.FormatWidth = uint16(p.fmt.Width) +} + +func (p *printer) initDecimal(minFrac, maxFrac int) { + f := &p.toDecimal + f.MinIntegerDigits = 1 + f.MaxIntegerDigits = 0 + f.MinFractionDigits = uint8(minFrac) + f.MaxFractionDigits = int16(maxFrac) + p.setFlags(f) + f.PadRune = 0 + if p.fmt.WidthPresent { + if p.fmt.Zero { + wid := p.fmt.Width + // Use significant integers for this. + // TODO: this is not the same as width, but so be it. + if f.MinFractionDigits > 0 { + wid -= 1 + int(f.MinFractionDigits) + } + if p.fmt.Plus || p.fmt.Space { + wid-- + } + if wid > 0 && wid > int(f.MinIntegerDigits) { + f.MinIntegerDigits = uint8(wid) + } + } + p.updatePadding(f) + } +} + +func (p *printer) initScientific(minFrac, maxFrac int) { + f := &p.toScientific + if maxFrac < 0 { + f.SetPrecision(maxFrac) + } else { + f.SetPrecision(maxFrac + 1) + f.MinFractionDigits = uint8(minFrac) + f.MaxFractionDigits = int16(maxFrac) + } + f.MinExponentDigits = 2 + p.setFlags(f) + f.PadRune = 0 + if p.fmt.WidthPresent { + f.Flags &^= number.PadMask + if p.fmt.Zero { + f.PadRune = f.Digit(0) + f.Flags |= number.PadAfterPrefix + } else { + f.PadRune = ' ' + f.Flags |= number.PadBeforePrefix + } + p.updatePadding(f) + } +} + +func (p *printer) fmtDecimalInt(v uint64, isSigned bool) { + var d number.Decimal + + f := &p.toDecimal + if p.fmt.PrecPresent { + p.setFlags(f) + f.MinIntegerDigits = uint8(p.fmt.Prec) + f.MaxIntegerDigits = 0 + f.MinFractionDigits = 0 + f.MaxFractionDigits = 0 + if p.fmt.WidthPresent { + p.updatePadding(f) + } + } else { + p.initDecimal(0, 0) + } + d.ConvertInt(p.toDecimal.RoundingContext, isSigned, v) + + out := p.toDecimal.Format([]byte(nil), &d) + p.Buffer.Write(out) +} + +func (p *printer) fmtDecimalFloat(v float64, size, prec int) { + var d number.Decimal + if p.fmt.PrecPresent { + prec = p.fmt.Prec + } + p.initDecimal(prec, prec) + d.ConvertFloat(p.toDecimal.RoundingContext, v, size) + + out := p.toDecimal.Format([]byte(nil), &d) + p.Buffer.Write(out) +} + +func (p *printer) fmtVariableFloat(v float64, size int) { + prec := -1 + if p.fmt.PrecPresent { + prec = p.fmt.Prec + } + var d number.Decimal + p.initScientific(0, prec) + d.ConvertFloat(p.toScientific.RoundingContext, v, size) + + // Copy logic of 'g' formatting from strconv. It is simplified a bit as + // we don't have to mind having prec > len(d.Digits). + shortest := prec < 0 + ePrec := prec + if shortest { + prec = len(d.Digits) + ePrec = 6 + } else if prec == 0 { + prec = 1 + ePrec = 1 + } + exp := int(d.Exp) - 1 + if exp < -4 || exp >= ePrec { + p.initScientific(0, prec) + + out := p.toScientific.Format([]byte(nil), &d) + p.Buffer.Write(out) + } else { + if prec > int(d.Exp) { + prec = len(d.Digits) + } + if prec -= int(d.Exp); prec < 0 { + prec = 0 + } + p.initDecimal(0, prec) + + out := p.toDecimal.Format([]byte(nil), &d) + p.Buffer.Write(out) + } +} + +func (p *printer) fmtScientific(v float64, size, prec int) { + var d number.Decimal + if p.fmt.PrecPresent { + prec = p.fmt.Prec + } + p.initScientific(prec, prec) + rc := p.toScientific.RoundingContext + d.ConvertFloat(rc, v, size) + + out := p.toScientific.Format([]byte(nil), &d) + p.Buffer.Write(out) + +} + +// fmtComplex formats a complex number v with +// r = real(v) and j = imag(v) as (r+ji) using +// fmtFloat for r and j formatting. +func (p *printer) fmtComplex(v complex128, size int, verb rune) { + // Make sure any unsupported verbs are found before the + // calls to fmtFloat to not generate an incorrect error string. + switch verb { + case 'v', 'b', 'g', 'G', 'f', 'F', 'e', 'E': + p.WriteByte('(') + p.fmtFloat(real(v), size/2, verb) + // Imaginary part always has a sign. + if math.IsNaN(imag(v)) { + // By CLDR's rules, NaNs do not use patterns or signs. As this code + // relies on AlwaysSign working for imaginary parts, we need to + // manually handle NaNs. + f := &p.toScientific + p.setFlags(f) + p.updatePadding(f) + p.setFlags(f) + nan := f.Symbol(number.SymNan) + extra := 0 + if w, ok := p.Width(); ok { + extra = w - utf8.RuneCountInString(nan) - 1 + } + if f.Flags&number.PadAfterNumber == 0 { + for ; extra > 0; extra-- { + p.WriteRune(f.PadRune) + } + } + p.WriteString(f.Symbol(number.SymPlusSign)) + p.WriteString(nan) + for ; extra > 0; extra-- { + p.WriteRune(f.PadRune) + } + p.WriteString("i)") + return + } + oldPlus := p.fmt.Plus + p.fmt.Plus = true + p.fmtFloat(imag(v), size/2, verb) + p.WriteString("i)") // TODO: use symbol? + p.fmt.Plus = oldPlus + default: + p.badVerb(verb) + } +} + +func (p *printer) fmtString(v string, verb rune) { + switch verb { + case 'v': + if p.fmt.SharpV { + p.fmt.fmt_q(v) + } else { + p.fmt.fmt_s(v) + } + case 's': + p.fmt.fmt_s(v) + case 'x': + p.fmt.fmt_sx(v, ldigits) + case 'X': + p.fmt.fmt_sx(v, udigits) + case 'q': + p.fmt.fmt_q(v) + case 'm': + ctx := p.cat.Context(p.tag, rawPrinter{p}) + if ctx.Execute(v) == catalog.ErrNotFound { + p.WriteString(v) + } + default: + p.badVerb(verb) + } +} + +func (p *printer) fmtBytes(v []byte, verb rune, typeString string) { + switch verb { + case 'v', 'd': + if p.fmt.SharpV { + p.WriteString(typeString) + if v == nil { + p.WriteString(nilParenString) + return + } + p.WriteByte('{') + for i, c := range v { + if i > 0 { + p.WriteString(commaSpaceString) + } + p.fmt0x64(uint64(c), true) + } + p.WriteByte('}') + } else { + p.WriteByte('[') + for i, c := range v { + if i > 0 { + p.WriteByte(' ') + } + p.fmt.fmt_integer(uint64(c), 10, unsigned, ldigits) + } + p.WriteByte(']') + } + case 's': + p.fmt.fmt_s(string(v)) + case 'x': + p.fmt.fmt_bx(v, ldigits) + case 'X': + p.fmt.fmt_bx(v, udigits) + case 'q': + p.fmt.fmt_q(string(v)) + default: + p.printValue(reflect.ValueOf(v), verb, 0) + } +} + +func (p *printer) fmtPointer(value reflect.Value, verb rune) { + var u uintptr + switch value.Kind() { + case reflect.Chan, reflect.Func, reflect.Map, reflect.Ptr, reflect.Slice, reflect.UnsafePointer: + u = value.Pointer() + default: + p.badVerb(verb) + return + } + + switch verb { + case 'v': + if p.fmt.SharpV { + p.WriteByte('(') + p.WriteString(value.Type().String()) + p.WriteString(")(") + if u == 0 { + p.WriteString(nilString) + } else { + p.fmt0x64(uint64(u), true) + } + p.WriteByte(')') + } else { + if u == 0 { + p.fmt.padString(nilAngleString) + } else { + p.fmt0x64(uint64(u), !p.fmt.Sharp) + } + } + case 'p': + p.fmt0x64(uint64(u), !p.fmt.Sharp) + case 'b', 'o', 'd', 'x', 'X': + if verb == 'd' { + p.fmt.Sharp = true // Print as standard go. TODO: does this make sense? + } + p.fmtInteger(uint64(u), unsigned, verb) + default: + p.badVerb(verb) + } +} + +func (p *printer) catchPanic(arg interface{}, verb rune) { + if err := recover(); err != nil { + // If it's a nil pointer, just say "". The likeliest causes are a + // Stringer that fails to guard against nil or a nil pointer for a + // value receiver, and in either case, "" is a nice result. + if v := reflect.ValueOf(arg); v.Kind() == reflect.Ptr && v.IsNil() { + p.WriteString(nilAngleString) + return + } + // Otherwise print a concise panic message. Most of the time the panic + // value will print itself nicely. + if p.panicking { + // Nested panics; the recursion in printArg cannot succeed. + panic(err) + } + + oldFlags := p.fmt.Parser + // For this output we want default behavior. + p.fmt.ClearFlags() + + p.WriteString(percentBangString) + p.WriteRune(verb) + p.WriteString(panicString) + p.panicking = true + p.printArg(err, 'v') + p.panicking = false + p.WriteByte(')') + + p.fmt.Parser = oldFlags + } +} + +func (p *printer) handleMethods(verb rune) (handled bool) { + if p.erroring { + return + } + // Is it a Formatter? + if formatter, ok := p.arg.(format.Formatter); ok { + handled = true + defer p.catchPanic(p.arg, verb) + formatter.Format(p, verb) + return + } + if formatter, ok := p.arg.(fmt.Formatter); ok { + handled = true + defer p.catchPanic(p.arg, verb) + formatter.Format(p, verb) + return + } + + // If we're doing Go syntax and the argument knows how to supply it, take care of it now. + if p.fmt.SharpV { + if stringer, ok := p.arg.(fmt.GoStringer); ok { + handled = true + defer p.catchPanic(p.arg, verb) + // Print the result of GoString unadorned. + p.fmt.fmt_s(stringer.GoString()) + return + } + } else { + // If a string is acceptable according to the format, see if + // the value satisfies one of the string-valued interfaces. + // Println etc. set verb to %v, which is "stringable". + switch verb { + case 'v', 's', 'x', 'X', 'q': + // Is it an error or Stringer? + // The duplication in the bodies is necessary: + // setting handled and deferring catchPanic + // must happen before calling the method. + switch v := p.arg.(type) { + case error: + handled = true + defer p.catchPanic(p.arg, verb) + p.fmtString(v.Error(), verb) + return + + case fmt.Stringer: + handled = true + defer p.catchPanic(p.arg, verb) + p.fmtString(v.String(), verb) + return + } + } + } + return false +} + +func (p *printer) printArg(arg interface{}, verb rune) { + p.arg = arg + p.value = reflect.Value{} + + if arg == nil { + switch verb { + case 'T', 'v': + p.fmt.padString(nilAngleString) + default: + p.badVerb(verb) + } + return + } + + // Special processing considerations. + // %T (the value's type) and %p (its address) are special; we always do them first. + switch verb { + case 'T': + p.fmt.fmt_s(reflect.TypeOf(arg).String()) + return + case 'p': + p.fmtPointer(reflect.ValueOf(arg), 'p') + return + } + + // Some types can be done without reflection. + switch f := arg.(type) { + case bool: + p.fmtBool(f, verb) + case float32: + p.fmtFloat(float64(f), 32, verb) + case float64: + p.fmtFloat(f, 64, verb) + case complex64: + p.fmtComplex(complex128(f), 64, verb) + case complex128: + p.fmtComplex(f, 128, verb) + case int: + p.fmtInteger(uint64(f), signed, verb) + case int8: + p.fmtInteger(uint64(f), signed, verb) + case int16: + p.fmtInteger(uint64(f), signed, verb) + case int32: + p.fmtInteger(uint64(f), signed, verb) + case int64: + p.fmtInteger(uint64(f), signed, verb) + case uint: + p.fmtInteger(uint64(f), unsigned, verb) + case uint8: + p.fmtInteger(uint64(f), unsigned, verb) + case uint16: + p.fmtInteger(uint64(f), unsigned, verb) + case uint32: + p.fmtInteger(uint64(f), unsigned, verb) + case uint64: + p.fmtInteger(f, unsigned, verb) + case uintptr: + p.fmtInteger(uint64(f), unsigned, verb) + case string: + p.fmtString(f, verb) + case []byte: + p.fmtBytes(f, verb, "[]byte") + case reflect.Value: + // Handle extractable values with special methods + // since printValue does not handle them at depth 0. + if f.IsValid() && f.CanInterface() { + p.arg = f.Interface() + if p.handleMethods(verb) { + return + } + } + p.printValue(f, verb, 0) + default: + // If the type is not simple, it might have methods. + if !p.handleMethods(verb) { + // Need to use reflection, since the type had no + // interface methods that could be used for formatting. + p.printValue(reflect.ValueOf(f), verb, 0) + } + } +} + +// printValue is similar to printArg but starts with a reflect value, not an interface{} value. +// It does not handle 'p' and 'T' verbs because these should have been already handled by printArg. +func (p *printer) printValue(value reflect.Value, verb rune, depth int) { + // Handle values with special methods if not already handled by printArg (depth == 0). + if depth > 0 && value.IsValid() && value.CanInterface() { + p.arg = value.Interface() + if p.handleMethods(verb) { + return + } + } + p.arg = nil + p.value = value + + switch f := value; value.Kind() { + case reflect.Invalid: + if depth == 0 { + p.WriteString(invReflectString) + } else { + switch verb { + case 'v': + p.WriteString(nilAngleString) + default: + p.badVerb(verb) + } + } + case reflect.Bool: + p.fmtBool(f.Bool(), verb) + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + p.fmtInteger(uint64(f.Int()), signed, verb) + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + p.fmtInteger(f.Uint(), unsigned, verb) + case reflect.Float32: + p.fmtFloat(f.Float(), 32, verb) + case reflect.Float64: + p.fmtFloat(f.Float(), 64, verb) + case reflect.Complex64: + p.fmtComplex(f.Complex(), 64, verb) + case reflect.Complex128: + p.fmtComplex(f.Complex(), 128, verb) + case reflect.String: + p.fmtString(f.String(), verb) + case reflect.Map: + if p.fmt.SharpV { + p.WriteString(f.Type().String()) + if f.IsNil() { + p.WriteString(nilParenString) + return + } + p.WriteByte('{') + } else { + p.WriteString(mapString) + } + keys := f.MapKeys() + for i, key := range keys { + if i > 0 { + if p.fmt.SharpV { + p.WriteString(commaSpaceString) + } else { + p.WriteByte(' ') + } + } + p.printValue(key, verb, depth+1) + p.WriteByte(':') + p.printValue(f.MapIndex(key), verb, depth+1) + } + if p.fmt.SharpV { + p.WriteByte('}') + } else { + p.WriteByte(']') + } + case reflect.Struct: + if p.fmt.SharpV { + p.WriteString(f.Type().String()) + } + p.WriteByte('{') + for i := 0; i < f.NumField(); i++ { + if i > 0 { + if p.fmt.SharpV { + p.WriteString(commaSpaceString) + } else { + p.WriteByte(' ') + } + } + if p.fmt.PlusV || p.fmt.SharpV { + if name := f.Type().Field(i).Name; name != "" { + p.WriteString(name) + p.WriteByte(':') + } + } + p.printValue(getField(f, i), verb, depth+1) + } + p.WriteByte('}') + case reflect.Interface: + value := f.Elem() + if !value.IsValid() { + if p.fmt.SharpV { + p.WriteString(f.Type().String()) + p.WriteString(nilParenString) + } else { + p.WriteString(nilAngleString) + } + } else { + p.printValue(value, verb, depth+1) + } + case reflect.Array, reflect.Slice: + switch verb { + case 's', 'q', 'x', 'X': + // Handle byte and uint8 slices and arrays special for the above verbs. + t := f.Type() + if t.Elem().Kind() == reflect.Uint8 { + var bytes []byte + if f.Kind() == reflect.Slice { + bytes = f.Bytes() + } else if f.CanAddr() { + bytes = f.Slice(0, f.Len()).Bytes() + } else { + // We have an array, but we cannot Slice() a non-addressable array, + // so we build a slice by hand. This is a rare case but it would be nice + // if reflection could help a little more. + bytes = make([]byte, f.Len()) + for i := range bytes { + bytes[i] = byte(f.Index(i).Uint()) + } + } + p.fmtBytes(bytes, verb, t.String()) + return + } + } + if p.fmt.SharpV { + p.WriteString(f.Type().String()) + if f.Kind() == reflect.Slice && f.IsNil() { + p.WriteString(nilParenString) + return + } + p.WriteByte('{') + for i := 0; i < f.Len(); i++ { + if i > 0 { + p.WriteString(commaSpaceString) + } + p.printValue(f.Index(i), verb, depth+1) + } + p.WriteByte('}') + } else { + p.WriteByte('[') + for i := 0; i < f.Len(); i++ { + if i > 0 { + p.WriteByte(' ') + } + p.printValue(f.Index(i), verb, depth+1) + } + p.WriteByte(']') + } + case reflect.Ptr: + // pointer to array or slice or struct? ok at top level + // but not embedded (avoid loops) + if depth == 0 && f.Pointer() != 0 { + switch a := f.Elem(); a.Kind() { + case reflect.Array, reflect.Slice, reflect.Struct, reflect.Map: + p.WriteByte('&') + p.printValue(a, verb, depth+1) + return + } + } + fallthrough + case reflect.Chan, reflect.Func, reflect.UnsafePointer: + p.fmtPointer(f, verb) + default: + p.unknownType(f) + } +} + +func (p *printer) badArgNum(verb rune) { + p.WriteString(percentBangString) + p.WriteRune(verb) + p.WriteString(badIndexString) +} + +func (p *printer) missingArg(verb rune) { + p.WriteString(percentBangString) + p.WriteRune(verb) + p.WriteString(missingString) +} + +func (p *printer) doPrintf(fmt string) { + for p.fmt.Parser.SetFormat(fmt); p.fmt.Scan(); { + switch p.fmt.Status { + case format.StatusText: + p.WriteString(p.fmt.Text()) + case format.StatusSubstitution: + p.printArg(p.Arg(p.fmt.ArgNum), p.fmt.Verb) + case format.StatusBadWidthSubstitution: + p.WriteString(badWidthString) + p.printArg(p.Arg(p.fmt.ArgNum), p.fmt.Verb) + case format.StatusBadPrecSubstitution: + p.WriteString(badPrecString) + p.printArg(p.Arg(p.fmt.ArgNum), p.fmt.Verb) + case format.StatusNoVerb: + p.WriteString(noVerbString) + case format.StatusBadArgNum: + p.badArgNum(p.fmt.Verb) + case format.StatusMissingArg: + p.missingArg(p.fmt.Verb) + default: + panic("unreachable") + } + } + + // Check for extra arguments, but only if there was at least one ordered + // argument. Note that this behavior is necessarily different from fmt: + // different variants of messages may opt to drop some or all of the + // arguments. + if !p.fmt.Reordered && p.fmt.ArgNum < len(p.fmt.Args) && p.fmt.ArgNum != 0 { + p.fmt.ClearFlags() + p.WriteString(extraString) + for i, arg := range p.fmt.Args[p.fmt.ArgNum:] { + if i > 0 { + p.WriteString(commaSpaceString) + } + if arg == nil { + p.WriteString(nilAngleString) + } else { + p.WriteString(reflect.TypeOf(arg).String()) + p.WriteString("=") + p.printArg(arg, 'v') + } + } + p.WriteByte(')') + } +} + +func (p *printer) doPrint(a []interface{}) { + prevString := false + for argNum, arg := range a { + isString := arg != nil && reflect.TypeOf(arg).Kind() == reflect.String + // Add a space between two non-string arguments. + if argNum > 0 && !isString && !prevString { + p.WriteByte(' ') + } + p.printArg(arg, 'v') + prevString = isString + } +} + +// doPrintln is like doPrint but always adds a space between arguments +// and a newline after the last argument. +func (p *printer) doPrintln(a []interface{}) { + for argNum, arg := range a { + if argNum > 0 { + p.WriteByte(' ') + } + p.printArg(arg, 'v') + } + p.WriteByte('\n') +} diff --git a/vendor/modules.txt b/vendor/modules.txt index 47bf6b7..52df61c 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -4,8 +4,8 @@ github.com/clipperhouse/uax29/v2/graphemes # github.com/davecgh/go-spew v1.1.1 ## explicit github.com/davecgh/go-spew/spew -# github.com/getkin/kin-openapi v0.133.0 -## explicit; go 1.22.5 +# github.com/getkin/kin-openapi v0.136.0 +## explicit; go 1.26 github.com/getkin/kin-openapi/openapi3 # github.com/go-chi/chi/v5 v5.2.5 ## explicit; go 1.22 @@ -81,15 +81,13 @@ github.com/mattn/go-runewidth # github.com/mitchellh/go-homedir v1.1.0 ## explicit github.com/mitchellh/go-homedir -# github.com/mitchellh/mapstructure v1.5.0 -## explicit; go 1.14 # github.com/mohae/deepcopy v0.0.0-20170929034955-c48cc78d4826 ## explicit github.com/mohae/deepcopy -# github.com/oasdiff/yaml v0.0.0-20250309154309-f31be36b4037 +# github.com/oasdiff/yaml v0.0.9 ## explicit; go 1.22.5 github.com/oasdiff/yaml -# github.com/oasdiff/yaml3 v0.0.0-20250309153720-d2182401db90 +# github.com/oasdiff/yaml3 v0.0.12 ## explicit; go 1.22.5 github.com/oasdiff/yaml3 # github.com/perimeterx/marshmallow v1.1.5 @@ -98,14 +96,16 @@ github.com/perimeterx/marshmallow # github.com/pmezard/go-difflib v1.0.0 ## explicit github.com/pmezard/go-difflib/difflib -# github.com/rivo/uniseg v0.4.7 -## explicit; go 1.18 # github.com/rs/zerolog v1.34.0 ## explicit; go 1.15 github.com/rs/zerolog github.com/rs/zerolog/internal/cbor github.com/rs/zerolog/internal/json github.com/rs/zerolog/log +# github.com/santhosh-tekuri/jsonschema/v6 v6.0.2 +## explicit; go 1.21 +github.com/santhosh-tekuri/jsonschema/v6 +github.com/santhosh-tekuri/jsonschema/v6/kind # github.com/stretchr/testify v1.11.1 ## explicit; go 1.17 github.com/stretchr/testify/assert @@ -119,6 +119,18 @@ golang.org/x/sys/unix golang.org/x/sys/windows # golang.org/x/text v0.34.0 ## explicit; go 1.24.0 +golang.org/x/text/feature/plural +golang.org/x/text/internal +golang.org/x/text/internal/catmsg +golang.org/x/text/internal/format +golang.org/x/text/internal/language +golang.org/x/text/internal/language/compact +golang.org/x/text/internal/number +golang.org/x/text/internal/stringset +golang.org/x/text/internal/tag +golang.org/x/text/language +golang.org/x/text/message +golang.org/x/text/message/catalog golang.org/x/text/transform golang.org/x/text/width # gopkg.in/yaml.v3 v3.0.1